![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_07550 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 104aa MW: 12588.4 Da PI: 10.0698 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.6 | 5.2e-33 | 30 | 88 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+ PEQU_07550 30 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHS 88 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.6E-34 | 15 | 88 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-29 | 22 | 88 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.897 | 25 | 87 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.5E-38 | 30 | 89 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.2E-26 | 31 | 87 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
KMSERGKIKI RRKMREPRFC FQTRSDVDVL DDGYKWRKYG QKVVKNSLHP RSYYRCTHNN 60 CRVKKRVERL SEDCRMVITT YEGRHTHSPC DDHNSPESEC FKAF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-26 | 21 | 87 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-26 | 21 | 87 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00618 | PBM | Transfer from AT2G44745 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020577590.1 | 1e-73 | probable WRKY transcription factor 12 | ||||
Swissprot | Q93WY4 | 1e-60 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A061DUM5 | 9e-64 | A0A061DUM5_THECC; WRKY family transcription factor | ||||
TrEMBL | A0A068UP64 | 2e-63 | A0A068UP64_COFCA; Uncharacterized protein | ||||
TrEMBL | M0TFC6 | 5e-64 | M0TFC6_MUSAM; Uncharacterized protein | ||||
STRING | EOX96509 | 2e-64 | (Theobroma cacao) | ||||
STRING | GSMUA_Achr7P06860_001 | 9e-65 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1138 | 38 | 130 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 6e-63 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|