PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_07550

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 104aa MW: 12588.4 Da PI: 10.0698

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_07550	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.6	5.2e-33	30	88	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+ PEQU_07550 30 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHS 88 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.6E-34	15	88	IPR003657	WRKY domain
SuperFamily	SSF118290	2.48E-29	22	88	IPR003657	WRKY domain
PROSITE profile	PS50811	28.897	25	87	IPR003657	WRKY domain
SMART	SM00774	7.5E-38	30	89	IPR003657	WRKY domain
Pfam	PF03106	6.2E-26	31	87	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
KMSERGKIKI RRKMREPRFC FQTRSDVDVL DDGYKWRKYG QKVVKNSLHP RSYYRCTHNN 60 CRVKKRVERL SEDCRMVITT YEGRHTHSPC DDHNSPESEC FKAF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-26	21	87	8	74	Probable WRKY transcription factor 4
2lex_A	1e-26	21	87	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00618	PBM	Transfer from AT2G44745	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020577590.1	1e-73	probable WRKY transcription factor 12
Swissprot	Q93WY4	1e-60	WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBL	A0A061DUM5	9e-64	A0A061DUM5_THECC; WRKY family transcription factor
TrEMBL	A0A068UP64	2e-63	A0A068UP64_COFCA; Uncharacterized protein
TrEMBL	M0TFC6	5e-64	M0TFC6_MUSAM; Uncharacterized protein
STRING	EOX96509	2e-64	(Theobroma cacao)
STRING	GSMUA_Achr7P06860_001	9e-65	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1138	38	130

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G44745.1	6e-63	WRKY family protein

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Yang L, et al. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa. Sci Rep, 2016. 6: p. 18643 [PMID:26819184] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Han Y, et al. WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 149-159 [PMID:30617455]