PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

MYB_related

Protein Properties

Length: 53aa MW: 6138.83 Da PI: 4.9646

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_06243	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.8	1.2e-13	3	45	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + ++T+eEd+l+++ k+ G + W++Ia +++ gRt +++ ++w PEQU_06243 3 KPNFTEEEDDLIARMYKLVGDR-WSLIAGRIP-GRTSEEIENYWK 45 579***************99.*****.*********7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.095	1	52	IPR017930	Myb domain
SMART	SM00717	2.4E-11	2	50	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.27E-11	2	46	IPR009057	Homeodomain-like
Pfam	PF00249	2.0E-12	3	45	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.4E-16	5	46	IPR009057	Homeodomain-like
CDD	cd00167	1.83E-9	5	45	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0009913	Biological Process	epidermal cell differentiation
GO:0010063	Biological Process	positive regulation of trichoblast fate specification
GO:0010091	Biological Process	trichome branching
GO:0080147	Biological Process	root hair cell development
GO:1900033	Biological Process	negative regulation of trichome patterning
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 53 aa Download sequence Send to blast
MSKPNFTEEE DDLIARMYKL VGDRWSLIAG RIPGRTSEEI ENYWKSKNST SST

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269\|PubMed:15063185, ECO:0000269\|PubMed:15584952}.
UniProt	Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:12356720, ECO:0000269\|PubMed:16291794, ECO:0000269\|PubMed:19513241, ECO:0000269\|PubMed:9262483}.
UniProt	Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269\|PubMed:10368181, ECO:0000269\|PubMed:12356720}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269\|PubMed:12356720}.
UniProt	INDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16176989, ECO:0000269\|PubMed:16207757, ECO:0000269\|PubMed:17450124, ECO:0000269\|PubMed:19513241}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012091344.1	3e-21	transcription factor CPC
Refseq	XP_021636068.1	2e-21	MYB-like transcription factor ETC1 isoform X1
Refseq	XP_021636069.1	2e-21	transcription factor CPC-like isoform X2
Refseq	XP_021636070.1	3e-21	transcription factor CPC-like isoform X1
Refseq	XP_021636071.1	3e-21	transcription factor CPC-like isoform X2
Swissprot	O22059	2e-18	CPC_ARATH; Transcription factor CPC
Swissprot	Q8GV05	3e-18	TRY_ARATH; Transcription factor TRY
Swissprot	Q9LNI5	2e-18	ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBL	A0A2I0VG99	7e-23	A0A2I0VG99_9ASPA; Transcription factor CPC
STRING	cassava4.1_026343m	3e-20	(Manihot esculenta)
STRING	XP_002518480.1	3e-20	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5275	31	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01380.1	8e-21	MYB_related family protein

Publications ? help Back to Top
Perazza D, et al. Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes. Genetics, 1999. 152(1): p. 461-76 [PMID:10224275] Scheres B Plant patterning: TRY to inhibit your neighbors. Curr. Biol., 2002. 12(23): p. R804-6 [PMID:12477405] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brininstool G, et al. Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development. BMC Plant Biol., 2008. 8: p. 58 [PMID:18485217] Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Taheri A, et al. A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population. Plant Biol (Stuttg), 2015. 17(2): p. 384-94 [PMID:25348773] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tominaga-Wada R,Wada T The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Kurata T,Wada T Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] Tominaga-Wada R,Kurata T,Wada T Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Tominaga-Wada R,Wada T Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079] Kribii R, et al. Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway. Eur. J. Biochem., 1997. 249(1): p. 61-9 [PMID:9363754]