PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

ARR-B

Protein Properties

Length: 173aa MW: 19647.8 Da PI: 8.3474

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_04699	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	72.1	8.4e-23	121	170	1	51
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kpr+ W+peLH +F++ v+qL G+ +A Pk+il+++++ gLt+e+v+SHLQ PEQU_04699 121 KPRVTWSPELHVKFINIVNQL-GISRAAPKKILDMLNISGLTRENVASHLQ 170 79*****************.*************************** PP
2	Response_reg	31.3	1e-11	1	55	53	108
CTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS Response_reg 53 mpgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108 mp+mdG++ll+ i e++lp+i+++ + + + + + Ga d+l+Kp+ eel PEQU_04699 1 MPDMDGFKLLE-IVGLEMDLPVIMLSVDCDVKNVMKGIMHGAVDYLAKPVRLEELK 55 9*******7.5556679*******************************9996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF52172	4.98E-15	1	70	IPR011006	CheY-like superfamily
CDD	cd00156	1.89E-12	1	61	No hit	No description
Pfam	PF00072	7.8E-9	1	55	IPR001789	Signal transduction response regulator, receiver domain
Gene3D	G3DSA:3.40.50.2300	3.3E-19	1	87	No hit	No description
PROSITE profile	PS50110	22.536	1	62	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS51294	9.541	118	173	IPR017930	Myb domain
SuperFamily	SSF46689	2.33E-13	119	170	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.8E-21	119	170	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.3E-18	121	171	IPR006447	Myb domain, plants
Pfam	PF00249	4.5E-6	123	170	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
MPDMDGFKLL EIVGLEMDLP VIMLSVDCDV KNVMKGIMHG AVDYLAKPVR LEELKLIWKH 60 VVRRSLNEKK DQNVTNKQLG HATKSEEDQK LRHTKKCKGH NKESDNEVCA DSDEDMNPQK 120 KPRVTWSPEL HVKFINIVNQ LGISRAAPKK ILDMLNISGL TRENVASHLQ VCS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	1e-18	117	170	1	54	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020578712.1	1e-121	two-component response regulator ORR23-like isoform X1
Refseq	XP_020578714.1	1e-121	two-component response regulator ARR18-like isoform X3
Refseq	XP_020578715.1	1e-121	two-component response regulator ARR18-like isoform X4
Refseq	XP_020578716.1	1e-121	two-component response regulator ARR18-like isoform X4
Refseq	XP_020578717.1	1e-122	two-component response regulator ARR18-like isoform X5
Swissprot	B8AEH1	3e-55	ORR23_ORYSI; Two-component response regulator ORR23
Swissprot	Q6K8X6	3e-55	ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBL	A0A2I0W9B1	3e-96	A0A2I0W9B1_9ASPA; Two-component response regulator ARR10
STRING	EOY29602	1e-57	(Theobroma cacao)
STRING	evm.model.supercontig_127.10	4e-59	(Carica papaya)
STRING	GSMUA_Achr10P23650_001	2e-58	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP11222	27	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	7e-53	response regulator 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]