![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s659881g001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 235aa MW: 26805.7 Da PI: 9.4899 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 151.2 | 5.1e-47 | 15 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeelvv+yL++kv + +l++ vi+e+d+ k++PwdLp ++e+e yfF r+ ky +gkr +rat sgyWkatgkdk++ PDK_30s659881g001 15 LPPGFRFHPTDEELVVHYLTRKVFSCPLPA-AVIPEIDLGKFDPWDLP---GGSEEEQYFFNLREAKYLSGKRFKRATLSGYWKATGKDKSI 102 79***************************9.89***************...4568899********************************** PP NAM 93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ ++lvglkk+Lvfy+g+ p+++ tdW+mheyrl PDK_30s659881g001 103 VASrCNQLVGLKKVLVFYRGKPPHASPTDWIMHEYRL 139 99867889***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-53 | 10 | 174 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.345 | 15 | 174 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.5E-25 | 16 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MEKPDFIIKY GVQRLPPGFR FHPTDEELVV HYLTRKVFSC PLPAAVIPEI DLGKFDPWDL 60 PGGSEEEQYF FNLREAKYLS GKRFKRATLS GYWKATGKDK SIVASRCNQL VGLKKVLVFY 120 RGKPPHASPT DWIMHEYRLA APETSAFSFP LRKFSAHRSM AHTKEWVVCR IFQKRRATRI 180 DAEIAPYCNY RRIRNNIEHV DPGASLSLSC VTDLSEDGEE GSSRSMASSS NGKEV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-44 | 15 | 179 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-44 | 15 | 179 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-44 | 15 | 179 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-44 | 15 | 179 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-44 | 15 | 179 | 20 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-44 | 15 | 179 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-44 | 15 | 179 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008790723.1 | 1e-177 | NAC domain-containing protein 83-like isoform X2 | ||||
Swissprot | Q9FY93 | 7e-72 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2H3XYT9 | 1e-175 | A0A2H3XYT9_PHODC; NAC domain-containing protein 83-like isoform X2 | ||||
STRING | XP_008790722.1 | 1e-163 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6317 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 7e-74 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|