PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s1019671g001

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

M-type_MADS

Protein Properties

Length: 75aa MW: 8626.19 Da PI: 10.6181

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s1019671g001	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.5	7.4e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s PDK_30s1019671g001 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.515	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.43E-39	2	61	No hit	No description
SuperFamily	SSF55455	2.62E-31	2	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.6E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.6E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.6E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SRSQGEGMLL LRFLC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	3e-20	1	61	1	61	MEF2 CHIMERA
6byy_B	3e-20	1	61	1	61	MEF2 CHIMERA
6byy_C	3e-20	1	61	1	61	MEF2 CHIMERA
6byy_D	3e-20	1	61	1	61	MEF2 CHIMERA
6bz1_A	3e-20	1	61	1	61	MEF2 CHIMERA
6bz1_B	3e-20	1	61	1	61	MEF2 CHIMERA
6bz1_C	3e-20	1	61	1	61	MEF2 CHIMERA
6bz1_D	3e-20	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in inflorescence development and floral organogenesis.
UniProt	Probable transcription factor active in inflorescence development and floral organogenesis. Functions with SEPALLATA1/AGL2 and SEPALLATA2/AGL4 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Interacts with APETALA1, AGAMOUS or APETALA3/PISTILLATA to form complexes, that could be involved in genes regulation during floral meristem development (PubMed:10821278, PubMed:11206550). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269\|PubMed:10821278, ECO:0000269\|PubMed:11206550, ECO:0000269\|PubMed:16080001}.
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF411845	4e-82	AF411845.1 Elaeis guineensis MADS box transcription factor (AGL2-3) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020205010.1	6e-37	developmental protein SEPALLATA 1 isoform X5
Swissprot	O04067	6e-37	AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog
Swissprot	O22456	7e-37	SEP3_ARATH; Developmental protein SEPALLATA 3
Swissprot	Q8LLR0	5e-37	MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBL	A0A438DXH4	5e-37	A0A438DXH4_VITVI; Agamous-like MADS-box protein AGL9-like
STRING	POPTR_0003s16800.1	2e-37	(Populus trichocarpa)
STRING	Pavir.J10600.1.p	2e-37	(Panicum virgatum)
STRING	Lus10011349	2e-37	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	2e-39	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Maejima K, et al. Recognition of floral homeotic MADS domain transcription factors by a phytoplasmal effector, phyllogen, induces phyllody. Plant J., 2014. 78(4): p. 541-54 [PMID:24597566] MacLean AM, et al. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS Biol., 2014. 12(4): p. e1001835 [PMID:24714165] Iglesias FM, et al. The arabidopsis DNA polymerase δ has a role in the deposition of transcriptionally active epigenetic marks, development and flowering. PLoS Genet., 2015. 11(2): p. e1004975 [PMID:25693187] He Q,Fu AY,Zhang GC,Li TJ,Zhang JH Arabidopsis thaliana SEPALLATA3 protein prokaryotic expression and purification. Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(2): p. 60-3 [PMID:26025404] Maejima K, et al. Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462] Muiño JM, et al. Evolution of DNA-Binding Sites of a Floral Master Regulatory Transcription Factor. Mol. Biol. Evol., 2016. 33(1): p. 185-200 [PMID:26429922] Shi Q,Zhou J,Wang P,Lin X,Xu Y Protein expression and characterization of SEP3 from Arabidopsis thaliana. Genet. Mol. Res., 2015. 14(4): p. 12529-36 [PMID:26505403] He Q,Fu AY,Zhang GC,Li TJ,Zhang JH Cloning, Prokaryotic Expression and Purification of CpfS1 Gene from Arabidopsis Thaliana. Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(8): p. 123-7 [PMID:26718440] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Soza VL,Snelson CD,Hewett Hazelton KD,Di Stilio VS Partial redundancy and functional specialization of E-class SEPALLATA genes in an early-diverging eudicot. Dev. Biol., 2016. 419(1): p. 143-155 [PMID:27502434] Conn VM, et al. A circRNA from SEPALLATA3 regulates splicing of its cognate mRNA through R-loop formation. Nat Plants, 2017. 3: p. 17053 [PMID:28418376] Käppel S,Melzer R,Rümpler F,Gafert C,Theißen G The floral homeotic protein SEPALLATA3 recognizes target DNA sequences by shape readout involving a conserved arginine residue in the MADS-domain. Plant J., 2018. 95(2): p. 341-357 [PMID:29744943] Bonhomme F,Sommer H,Bernier G,Jacqmard A Characterization of SaMADS D from Sinapis alba suggests a dual function of the gene: in inflorescence development and floral organogenesis. Plant Mol. Biol., 1997. 34(4): p. 573-82 [PMID:9247539]