![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100268870121 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 121aa MW: 14205.3 Da PI: 8.6555 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 65.8 | 7.7e-21 | 30 | 76 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd+ ++++v+++G++ W+tIa++++ gR +kqc++rw+++l Ote100268870121|100268870121 30 KGPWSKEEDDVIIELVNKYGPKKWSTIANHLP-GRIGKQCRERWHNHL 76 79******************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 27.4 | 8.1e-09 | 82 | 120 | 1 | 41 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 + +WT++E++ l++a++ G++ W+ + ++ gR ++++ Ote100268870121|100268870121 82 KEAWTQDEELTLIRAHQVIGNK-WAELTKFLP-GRYMNSLV 120 579*******************.*********.**988886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 3.973 | 1 | 24 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-11 | 6 | 36 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 33.143 | 25 | 80 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.37E-28 | 27 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-18 | 29 | 78 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-19 | 30 | 76 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.18E-15 | 32 | 76 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-28 | 37 | 83 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.276 | 81 | 121 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2 | 81 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.2E-7 | 82 | 119 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 0.00393 | 84 | 121 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-13 | 84 | 118 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MICSAECFKD RTDVQCLHRW QKVLNPDLVK GPWSKEEDDV IIELVNKYGP KKWSTIANHL 60 PGRIGKQCRE RWHNHLNPNI NKEAWTQDEE LTLIRAHQVI GNKWAELTKF LPGRYMNSLV 120 S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 9e-54 | 5 | 119 | 33 | 147 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 9e-54 | 5 | 119 | 33 | 147 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027085372.1 | 1e-71 | transcription factor MYB3R-1-like isoform X1 | ||||
Swissprot | Q9S7G7 | 1e-67 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | A0A4D8YDK1 | 6e-71 | A0A4D8YDK1_SALSN; Uncharacterized protein | ||||
TrEMBL | A0A4D8ZV10 | 5e-74 | A0A4D8ZV10_SALSN; Uncharacterized protein | ||||
TrEMBL | A0A4D9B492 | 8e-71 | A0A4D9B492_SALSN; Uncharacterized protein | ||||
STRING | evm.model.supercontig_78.76 | 2e-70 | (Carica papaya) | ||||
STRING | XP_010100271.1 | 2e-70 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA10393 | 20 | 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|