PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100266890031

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

HSF

Protein Properties

Length: 243aa MW: 28388.1 Da PI: 7.8545

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100266890031	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	107.1	1.4e-33	75	174	2	103
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFk 82 Fl+k++e+++d+e++++isws +++sf+++d++++ +++Lp+yFkh+nf+SFvRQLn+Y F+ +++ +k +++ weF+ Ote100266890031\|100266890031 75 FLRKTFEMVDDAETNSIISWSFSKESFIIWDPHKLCTDLLPNYFKHNNFSSFVRQLNTYRFNPFEQRFRK--INPERWEFA 153 9******************888*************************************99976..5699* PP ESXXXXXXXXXXXXXXXXXXX CS HSF_DNA-bind 83 hksFkkgkkellekikrkkse 103 ++ F++gkk+ll++ikr++++ Ote100266890031\|100266890031 154 NEGFQQGKKHLLKHIKRRNHQ 174 ****************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00415	7.5E-48	71	171	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Gene3D	G3DSA:1.10.10.10	2.2E-36	71	171	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	4.26E-31	71	171	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	7.1E-29	75	171	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.4E-15	75	98	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.4E-15	113	125	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.4E-15	126	138	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 243 aa Download sequence Send to blast
MSENGMKTVS GVEKVGFGFV EKDNEVFVSI KEEPLAFVDE DDQNNLDGGF GGGEWAEEEV 60 PRAMAGIRED GPPPFLRKTF EMVDDAETNS IISWSFSKES FIIWDPHKLC TDLLPNYFKH 120 NNFSSFVRQL NTYRFNPFEQ RFRKINPERW EFANEGFQQG KKHLLKHIKR RNHQKQPCKE 180 LHKLRDDHNS FRNQIMELKH QHHASLHHLA SLADRLRATQ TKQNQMLAFM IKSLKNPLSA 240 LPH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	2e-18	73	171	27	129	Heat shock factor protein 1
5d5v_B	2e-18	73	171	27	129	Heat shock factor protein 1
5d5v_D	2e-18	73	171	27	129	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress responses. Seems to be involved in other environmental stress responses. Activates ascorbate peroxidase 2 (APX2) in addition to several heat shock protein (HSPs). {ECO:0000269\|PubMed:16649111, ECO:0000269\|PubMed:17059409, ECO:0000269\|PubMed:17085506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress, high light and hydrogen peroxide (H(2)O(2)). {ECO:0000269\|PubMed:16649111, ECO:0000269\|PubMed:17059409, ECO:0000269\|PubMed:17085506}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012848013.1	8e-75	PREDICTED: heat stress transcription factor A-7b-like
Swissprot	O80982	2e-58	HSFA2_ARATH; Heat stress transcription factor A-2
TrEMBL	A0A022QI69	2e-73	A0A022QI69_ERYGU; Uncharacterized protein
STRING	Migut.L01507.1.p	3e-74	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA5681	22	35

Publications ? help Back to Top
Liu HC,Charng YY Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Chauhan H,Khurana N,Agarwal P,Khurana JP,Khurana P A seed preferential heat shock transcription factor from wheat provides abiotic stress tolerance and yield enhancement in transgenic Arabidopsis under heat stress environment. PLoS ONE, 2013. 8(11): p. e79577 [PMID:24265778] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Weng M, et al. Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] Jang YH, et al. A homolog of splicing factor SF1 is essential for development and is involved in the alternative splicing of pre-mRNA in Arabidopsis thaliana. Plant J., 2014. 78(4): p. 591-603 [PMID:24580679] Stief A, et al. Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors. Plant Cell, 2014. 26(4): p. 1792-1807 [PMID:24769482] Dobrá J, et al. The impact of heat stress targeting on the hormonal and transcriptomic response in Arabidopsis. Plant Sci., 2015. 231: p. 52-61 [PMID:25575991] Yamauchi Y,Kunishima M,Mizutani M,Sugimoto Y Reactive short-chain leaf volatiles act as powerful inducers of abiotic stress-related gene expression. Sci Rep, 2015. 5: p. 8030 [PMID:25619826] Shi H, et al. Melatonin induces class A1 heat-shock factors (HSFA1s) and their possible involvement of thermotolerance in Arabidopsis. J. Pineal Res., 2015. 58(3): p. 335-42 [PMID:25711624] Mueller SP,Krause DM,Mueller MJ,Fekete A Accumulation of extra-chloroplastic triacylglycerols in Arabidopsis seedlings during heat acclimation. J. Exp. Bot., 2015. 66(15): p. 4517-26 [PMID:25977236] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Nguyen AH, et al. Loss of Arabidopsis 5'-3' Exoribonuclease AtXRN4 Function Enhances Heat Stress Tolerance of Plants Subjected to Severe Heat Stress. Plant Cell Physiol., 2015. 56(9): p. 1762-72 [PMID:26136597] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Lämke J,Brzezinka K,Bäurle I HSFA2 orchestrates transcriptional dynamics after heat stress in Arabidopsis thaliana. Transcription, 2016. 7(4): p. 111-4 [PMID:27383578] Wang X,Huang W,Liu J,Yang Z,Huang B Molecular regulation and physiological functions of a novel FaHsfA2c cloned from tall fescue conferring plant tolerance to heat stress. Plant Biotechnol. J., 2017. 15(2): p. 237-248 [PMID:27500592] Chen ST,He NY,Chen JH,Guo FQ Identification of core subunits of photosystem II as action sites of HSP21, which is activated by the GUN5-mediated retrograde pathway in Arabidopsis. Plant J., 2017. 89(6): p. 1106-1118 [PMID:27943531] Kataoka R,Takahashi M,Suzuki N Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis. Plant Signal Behav, 2017. 12(11): p. e1376159 [PMID:28873003] Wang X,Zhuang L,Shi Y,Huang B Up-Regulation of HSFA2c and HSPs by ABA Contributing to Improved Heat Tolerance in Tall Fescue and Arabidopsis. Int J Mol Sci, 2018. [PMID:28914758] Llamas E,Pulido P,Rodriguez-Concepcion M Interference with plastome gene expression and Clp protease activity in Arabidopsis triggers a chloroplast unfolded protein response to restore protein homeostasis. PLoS Genet., 2017. 13(9): p. e1007022 [PMID:28937985] Li X, et al. Plastid Translation Elongation Factor Tu Is Prone to Heat-Induced Aggregation Despite Its Critical Role in Plant Heat Tolerance. Plant Physiol., 2018. 176(4): p. 3027-3045 [PMID:29444814]