![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100240980011 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | LFY | ||||||||
Protein Properties | Length: 98aa MW: 11046.4 Da PI: 8.0154 | ||||||||
Description | LFY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FLO_LFY | 169.5 | 3.1e-52 | 1 | 84 | 302 | 385 |
FLO_LFY 302 mrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChler 382 mrhYvhCYalhcLde as+alrra+ker+e +G+wrqacy+plvaiaa+qgwdi+a+f++hprLs+WYvP kLrqLCh++r Ote100240980011|100240980011 1 MRHYVHCYALHCLDEPASDALRRAYKERNESIGSWRQACYEPLVAIAATQGWDIEAIFSHHPRLSVWYVPSKLRQLCHANR 81 9*******************************************************************************9 PP FLO_LFY 383 ska 385 ++ Ote100240980011|100240980011 82 ISS 84 876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF01698 | 1.2E-49 | 1 | 84 | IPR002910 | Floricaula/leafy protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MRHYVHCYAL HCLDEPASDA LRRAYKERNE SIGSWRQACY EPLVAIAATQ GWDIEAIFSH 60 HPRLSVWYVP SKLRQLCHAN RISSASTSAT TGGGEAHH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2vy1_A | 7e-45 | 1 | 94 | 80 | 173 | PROTEIN LEAFY |
2vy2_A | 7e-45 | 1 | 94 | 80 | 173 | PROTEIN LEAFY |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for flower development. FLO may interact in a sequential manner with other homeotic genes affecting floral organ identity. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001280945.1 | 1e-48 | floricaula/leafy homolog | ||||
Refseq | XP_023873133.1 | 2e-49 | protein UNIFOLIATA-like, partial | ||||
Swissprot | P23915 | 5e-47 | FLO_ANTMA; Floricaula protein | ||||
TrEMBL | W8VNP3 | 8e-48 | W8VNP3_PYRPY; LEAFY protein | ||||
STRING | XP_008392692.1 | 5e-48 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6668 | 23 | 33 |
Publications ? help Back to Top | |||
---|---|---|---|
|