PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100205980031 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 66aa MW: 7301.08 Da PI: 4.1258 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 37.5 | 3.4e-12 | 20 | 65 | 243 | 288 |
GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288 +qe+++n++++l+r+ ++ eyy+alfdsl+a++p+++++r +E+ Ote100205980031|100205980031 20 HQELNTNTAPLLARVRDTYEYYAALFDSLDATVPSQNSDRLRIEEG 65 89*****************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 9.468 | 1 | 66 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 1.2E-9 | 20 | 65 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MAANLAILEA AAEDGYSKIH QELNTNTAPL LARVRDTYEY YAALFDSLDA TVPSQNSDRL 60 RIEEGL |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012851921.1 | 4e-18 | PREDICTED: scarecrow-like protein 8 | ||||
TrEMBL | A0A022QAZ5 | 3e-18 | A0A022QAZ5_ERYGU; Uncharacterized protein (Fragment) | ||||
STRING | Migut.F00310.1.p | 9e-20 | (Erythranthe guttata) |