PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100202150021 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 88aa MW: 9660.05 Da PI: 4.1948 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 56 | 8.2e-18 | 25 | 86 | 158 | 219 |
GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvs 219 l e+g+rLa++Ae+++v+fe++ +va++l+dl+ +++++k+gE++aVn++++lh+ll+++++ Ote100202150021|100202150021 25 LAEVGWRLAQLAESINVEFEYRGFVASSLADLDASMFDIKEGETVAVNSIFELHQLLARPAA 86 689******************************************************88775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 11.871 | 1 | 88 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.8E-15 | 25 | 86 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MACAEAVQQE NFKLAEALVK KIGFLAEVGW RLAQLAESIN VEFEYRGFVA SSLADLDASM 60 FDIKEGETVA VNSIFELHQL LARPAAID |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011070609.1 | 2e-31 | DELLA protein GAI1 | ||||
Swissprot | Q8S4W7 | 1e-27 | GAI1_VITVI; DELLA protein GAI1 | ||||
TrEMBL | A0A4D8YN34 | 4e-31 | A0A4D8YN34_SALSN; DELLA protein | ||||
TrEMBL | A0A4D8Z1J7 | 5e-32 | A0A4D8Z1J7_SALSN; DELLA protein | ||||
TrEMBL | B9VRA7 | 5e-31 | B9VRA7_9LAMI; Putative gibberellin signaling DELLA protein | ||||
STRING | Migut.E00445.1.p | 1e-29 | (Erythranthe guttata) |