PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100177150051

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

Protein Properties

Length: 121aa MW: 13866 Da PI: 10.5504

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100177150051	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	61.3	1.6e-19	2	57	42	97
TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS B3 42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 +g++W+++++y+++s++yvltkGW++Fvk+++L++gD+v F+++ +++l++ + Ote100177150051\|100177150051 2 KGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKDLRAGDIVSFQRSTGLDKQLYIDWK 57 69****************************************87666666777665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	13.098	1	60	IPR003340	B3 DNA binding domain
SuperFamily	SSF101936	1.14E-16	2	58	IPR015300	DNA-binding pseudobarrel domain
Gene3D	G3DSA:2.40.330.10	4.8E-23	2	67	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	1.3E-16	2	59	IPR003340	B3 DNA binding domain
CDD	cd10017	7.81E-15	3	45	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MKGKVWRFRY SYWNSSQSYV LTKGWSRFVK EKDLRAGDIV SFQRSTGLDK QLYIDWKSRK 60 AGAEPAATSS ARPNPVQMFR LFGVNIEPAV DCSDSCSGKR MREMEIMGLS CSKKQRIINA 120 L

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wid_A	3e-31	1	71	59	129	DNA-binding protein RAV1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1. {ECO:0000250, ECO:0000269\|PubMed:18718758, ECO:0000305}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011070834.1	2e-56	AP2/ERF and B3 domain-containing transcription factor RAV1-like
Swissprot	P82280	8e-44	RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2
TrEMBL	A0A2G9GW46	1e-57	A0A2G9GW46_9LAMI; Uncharacterized protein
STRING	Migut.E00306.1.p	1e-51	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA5252	23	39

Publications ? help Back to Top
Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S RAV genes: regulation of floral induction and beyond. Ann. Bot., 2014. 114(7): p. 1459-70 [PMID:24812253] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Sun YW, et al. Attenuation of Histone Methyltransferase KRYPTONITE-mediated transcriptional gene silencing by Geminivirus. Sci Rep, 2015. 5: p. 16476 [PMID:26602265] Mittal A,Jiang Y,Ritchie GL,Burke JJ,Rock CD AtRAV1 and AtRAV2 overexpression in cotton increases fiber length differentially under drought stress and delays flowering. Plant Sci., 2015. 241: p. 78-95 [PMID:26706061] Matías-Hernández L, et al. TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation. Plant Physiol., 2016. 170(3): p. 1624-39 [PMID:26802039] Li P, et al. The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses. Physiol Plant, 2017. 159(4): p. 416-432 [PMID:27747895]