PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100035960031

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

NF-YB

Protein Properties

Length: 107aa MW: 11475.1 Da PI: 4.8664

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100035960031	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	146.2	7.1e-46	11	95	2	86
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 ++q+r+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+easdkc++e+rktingdd++ a+a lGf+dy++plk Ote100035960031\|100035960031 11 SDQERLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTGEASDKCRKERRKTINGDDICSAMAALGFDDYAAPLK 93 689*******************************************************************************9 PP NF-YB 85 vy 86 Ote100035960031\|100035960031 94 RS 95 76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.2E-43	6	95	IPR009072	Histone-fold
SuperFamily	SSF47113	3.73E-33	13	96	IPR009072	Histone-fold
Pfam	PF00808	8.3E-27	16	80	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	6.6E-11	44	62	No hit	No description
PRINTS	PR00615	6.6E-11	63	81	No hit	No description
PRINTS	PR00615	6.6E-11	82	100	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MADEGGSSSS SDQERLLPIA NVGRIMKQIL PPNAKISKEA KETMQECVSE FIGFVTGEAS 60 DKCRKERRKT INGDDICSAM AALGFDDYAA PLKRSIGGLV PPPAMDN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	9e-38	12	93	3	84	Transcription factor HapC (Eurofung)
4g92_B	9e-38	12	93	3	84	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019068761.1	2e-52	nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	6e-48	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A3Q7EG93	4e-51	A0A3Q7EG93_SOLLC; Uncharacterized protein
STRING	Solyc01g067130.2.1	7e-52	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]