PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100035960031 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 107aa MW: 11475.1 Da PI: 4.8664 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 146.2 | 7.1e-46 | 11 | 95 | 2 | 86 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 ++q+r+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+easdkc++e+rktingdd++ a+a lGf+dy++plk Ote100035960031|100035960031 11 SDQERLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTGEASDKCRKERRKTINGDDICSAMAALGFDDYAAPLK 93 689*******************************************************************************9 PP NF-YB 85 vy 86 Ote100035960031|100035960031 94 RS 95 76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-43 | 6 | 95 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.73E-33 | 13 | 96 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.3E-27 | 16 | 80 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.6E-11 | 44 | 62 | No hit | No description |
PRINTS | PR00615 | 6.6E-11 | 63 | 81 | No hit | No description |
PRINTS | PR00615 | 6.6E-11 | 82 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MADEGGSSSS SDQERLLPIA NVGRIMKQIL PPNAKISKEA KETMQECVSE FIGFVTGEAS 60 DKCRKERRKT INGDDICSAM AALGFDDYAA PLKRSIGGLV PPPAMDN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-38 | 12 | 93 | 3 | 84 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-38 | 12 | 93 | 3 | 84 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019068761.1 | 2e-52 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 6e-48 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A3Q7EG93 | 4e-51 | A0A3Q7EG93_SOLLC; Uncharacterized protein | ||||
STRING | Solyc01g067130.2.1 | 7e-52 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Publications ? help Back to Top | |||
---|---|---|---|
|