PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100016810091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family B3
Protein Properties Length: 272aa    MW: 30712.7 Da    PI: 10.2603
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100016810091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.39.6e-12150246296
                                   EEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT CS
                            B3   2 fkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkeg 77 
                                   +kvl++sdv+++gr+vlpkk ae+h            ktl l      +  + l    k + ++l++   eFv+ ngL+eg
  Ote100016810091|100016810091 150 QKVLKQSDVGNLGRIVLPKKEAESHlpeleTXXXXXXKTLELPVFGICVIGFGL--ITKAECIFLRTQVGEFVRVNGLQEG 228
                                   79***********************99776333446678888888889999999..67777799***************** PP

                                   -EEEEEE-SS.SEE..EEEE CS
                            B3  78 DfvvFkldgr.sefelvvkv 96 
                                   Df+v++  ++ ++++++++ 
  Ote100016810091|100016810091 229 DFIVIY--SDtKCGKYMIRG 246
                                   ******..444999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.3E-16143249IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-13148243IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.5E-6149250IPR003340B3 DNA binding domain
PfamPF023621.1E-8150245IPR003340B3 DNA binding domain
CDDcd100171.57E-10156245No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEHAPSWAML PPPSQFSPFP EIGGIINRHQ SLCGNPYQML DPNGQRMMRL GSSATKEARK  60
KRMARQRRMY SHHHRHVNQQ QDHLNDTNLV GEGVEDCDQG SSLGNLVYWS AEAAQPNSSD  120
RTTVQARQAS FDRRQQQGWK TEKNLKLLLQ KVLKQSDVGN LGRIVLPKKE AESHLPELET  180
XXXXXXKTLE LPVFGICVIG FGLITKAECI FLRTQVGEFV RVNGLQEGDF IVIYSDTKCG  240
KYMIRGVKVR HPGGKLEGKK AARRNIRTIS SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j9b_A4e-151452481105B3 domain-containing transcription factor FUS3
6j9b_D4e-151452481105B3 domain-containing transcription factor FUS3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtParticipates in abscisic acid-regulated gene expression during seed development. Regulates the transcription of SGR1 and SGR2 that are involved in leaf and embryo degreening. {ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:24043799}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:19783648}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080160.11e-103B3 domain-containing transcription factor ABI3 isoform X1
SwissprotQ015931e-56ABI3_ARATH; B3 domain-containing transcription factor ABI3
TrEMBLA0A2G9IAV31e-105A0A2G9IAV3_9LAMI; Uncharacterized protein
STRINGMigut.D00511.1.p1e-78(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42702339
Publications ? help Back to Top
  1. Zeng Y,Kermode AR
    A gymnosperm ABI3 gene functions in a severe abscisic acid-insensitive mutant of Arabidopsis (abi3-6) to restore the wild-type phenotype and demonstrates a strong synergistic effect with sugar in the inhibition of post-germinative growth.
    Plant Mol. Biol., 2004. 56(5): p. 731-46
    [PMID:15803411]
  2. Seifert M,Keilwagen J,Strickert M,Grosse I
    Utilizing gene pair orientations for HMM-based analysis of promoter array ChIP-chip data.
    Bioinformatics, 2009. 25(16): p. 2118-25
    [PMID:19401402]
  3. Yang C, et al.
    VAL- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis.
    Curr. Biol., 2013. 23(14): p. 1324-9
    [PMID:23810531]
  4. Duarte GT, et al.
    Involvement of microRNA-related regulatory pathways in the glucose-mediated control of Arabidopsis early seedling development.
    J. Exp. Bot., 2013. 64(14): p. 4301-12
    [PMID:23997203]
  5. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  6. Bu Q, et al.
    Regulation of drought tolerance by the F-box protein MAX2 in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 424-39
    [PMID:24198318]
  7. Gao DY, et al.
    Functional analyses of an E3 ligase gene AIP2 from wheat in Arabidopsis revealed its roles in seed germination and pre-harvest sprouting.
    J Integr Plant Biol, 2014. 56(5): p. 480-91
    [PMID:24279988]
  8. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  9. Molitor AM,Bu Z,Yu Y,Shen WH
    Arabidopsis AL PHD-PRC1 complexes promote seed germination through H3K4me3-to-H3K27me3 chromatin state switch in repression of seed developmental genes.
    PLoS Genet., 2014. 10(1): p. e1004091
    [PMID:24465219]
  10. Suzuki M,Wu S,Li Q,McCarty DR
    Distinct functions of COAR and B3 domains of maize VP1 in induction of ectopic gene expression and plant developmental phenotypes in Arabidopsis.
    Plant Mol. Biol., 2014. 85(1-2): p. 179-91
    [PMID:24473899]
  11. Xie M, et al.
    AtWNK9 is regulated by ABA and dehydration and is involved in drought tolerance in Arabidopsis.
    Plant Physiol. Biochem., 2014. 77: p. 73-83
    [PMID:24561249]
  12. Chen C, et al.
    ASCORBATE PEROXIDASE6 protects Arabidopsis desiccating and germinating seeds from stress and mediates cross talk between reactive oxygen species, abscisic acid, and auxin.
    Plant Physiol., 2014. 166(1): p. 370-83
    [PMID:25049361]
  13. Rikiishi K,Maekawa M
    Seed maturation regulators are related to the control of seed dormancy in wheat (Triticum aestivum L.).
    PLoS ONE, 2014. 9(9): p. e107618
    [PMID:25211528]
  14. Yamamoto A, et al.
    Cell-by-cell developmental transition from embryo to post-germination phase revealed by heterochronic gene expression and ER-body formation in Arabidopsis leafy cotyledon mutants.
    Plant Cell Physiol., 2014. 55(12): p. 2112-25
    [PMID:25282558]
  15. Bello B, et al.
    Cloning of Gossypium hirsutum sucrose non-fermenting 1-related protein kinase 2 gene (GhSnRK2) and its overexpression in transgenic Arabidopsis escalates drought and low temperature tolerance.
    PLoS ONE, 2014. 9(11): p. e112269
    [PMID:25393623]
  16. Chen C,Twito S,Miller G
    New cross talk between ROS, ABA and auxin controlling seed maturation and germination unraveled in APX6 deficient Arabidopsis seeds.
    Plant Signal Behav, 2014. 9(12): p. e976489
    [PMID:25482750]
  17. Shen Y,Devic M,Lepiniec L,Zhou DX
    Chromodomain, Helicase and DNA-binding CHD1 protein, CHR5, are involved in establishing active chromatin state of seed maturation genes.
    Plant Biotechnol. J., 2015. 13(6): p. 811-20
    [PMID:25581843]
  18. Zhao M,Yang S,Liu X,Wu K
    Arabidopsis histone demethylases LDL1 and LDL2 control primary seed dormancy by regulating DELAY OF GERMINATION 1 and ABA signaling-related genes.
    Front Plant Sci, 2015. 6: p. 159
    [PMID:25852712]
  19. Mukhopadhyay P,Tyagi AK
    OsTCP19 influences developmental and abiotic stress signaling by modulating ABI4-mediated pathways.
    Sci Rep, 2015. 5: p. 9998
    [PMID:25925167]
  20. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  21. Zhang GZ, et al.
    Ectopic expression of UGT75D1, a glycosyltransferase preferring indole-3-butyric acid, modulates cotyledon development and stress tolerance in seed germination of Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 90(1-2): p. 77-93
    [PMID:26496910]
  22. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  23. Dekkers BJ, et al.
    The Arabidopsis DELAY OF GERMINATION 1 gene affects ABSCISIC ACID INSENSITIVE 5 (ABI5) expression and genetically interacts with ABI3 during Arabidopsis seed development.
    Plant J., 2016. 85(4): p. 451-65
    [PMID:26729600]
  24. Huang Y,Feng CZ,Ye Q,Wu WH,Chen YF
    Arabidopsis WRKY6 Transcription Factor Acts as a Positive Regulator of Abscisic Acid Signaling during Seed Germination and Early Seedling Development.
    PLoS Genet., 2016. 12(2): p. e1005833
    [PMID:26829043]
  25. Abraham Z, et al.
    A Developmental Switch of Gene Expression in the Barley Seed Mediated by HvVP1 (Viviparous-1) and HvGAMYB Interactions.
    Plant Physiol., 2016. 170(4): p. 2146-58
    [PMID:26858366]
  26. Salas-Muñoz S,Rodríguez-Hernández AA,Ortega-Amaro MA,Salazar-Badillo FB,Jiménez-Bremont JF
    Arabidopsis AtDjA3 Null Mutant Shows Increased Sensitivity to Abscisic Acid, Salt, and Osmotic Stress in Germination and Post-germination Stages.
    Front Plant Sci, 2016. 7: p. 220
    [PMID:26941772]
  27. Kim SI,Kwak JS,Song JT,Seo HS
    The E3 SUMO ligase AtSIZ1 functions in seed germination in Arabidopsis.
    Physiol Plant, 2016. 158(3): p. 256-271
    [PMID:27130140]
  28. Baud S, et al.
    Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed.
    Plant Physiol., 2016. 171(2): p. 1099-112
    [PMID:27208266]
  29. Bedi S,Sengupta S,Ray A,Nag Chaudhuri R
    ABI3 mediates dehydration stress recovery response in Arabidopsis thaliana by regulating expression of downstream genes.
    Plant Sci., 2016. 250: p. 125-140
    [PMID:27457990]
  30. Fatihi A, et al.
    Deciphering and modifying LAFL transcriptional regulatory network in seed for improving yield and quality of storage compounds.
    Plant Sci., 2016. 250: p. 198-204
    [PMID:27457996]
  31. Zhu Z, et al.
    Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance.
    Front Plant Sci, 2016. 7: p. 1285
    [PMID:27625663]
  32. Feng J,Chen D,Berr A,Shen WH
    ZRF1 Chromatin Regulators Have Polycomb Silencing and Independent Roles in Development.
    Plant Physiol., 2016. 172(3): p. 1746-1759
    [PMID:27630184]
  33. Wu JR, et al.
    The Arabidopsis heat-intolerant 5 (hit5)/enhanced response to aba 1 (era1) mutant reveals the crucial role of protein farnesylation in plant responses to heat stress.
    New Phytol., 2017. 213(3): p. 1181-1193
    [PMID:27673599]
  34. Gu L, et al.
    An RRM-containing mei2-like MCT1 plays a negative role in the seed germination and seedling growth of Arabidopsis thaliana in the presence of ABA.
    Plant Physiol. Biochem., 2016. 109: p. 273-279
    [PMID:27771580]
  35. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]
  36. Xu J, et al.
    A Novel RNA-Binding Protein Involves ABA Signaling by Post-transcriptionally Repressing ABI2.
    Front Plant Sci, 2017. 8: p. 24
    [PMID:28174577]
  37. Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X
    An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment.
    Front Plant Sci, 2017. 8: p. 277
    [PMID:28293251]
  38. Le Hir R, et al.
    AtbHLH68 transcription factor contributes to the regulation of ABA homeostasis and drought stress tolerance in Arabidopsis thaliana.
    Physiol Plant, 2017. 160(3): p. 312-327
    [PMID:28369972]
  39. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]
  40. Li K,Yang F,Miao Y,Song CP
    Abscisic acid signaling is involved in regulating the mitogen-activated protein kinase cascade module, AIK1-MKK5-MPK6.
    Plant Signal Behav, 2017. 12(5): p. e1321188
    [PMID:28494202]
  41. Bi B,Tang J,Han S,Guo J,Miao Y
    Sinapic acid or its derivatives interfere with abscisic acid homeostasis during Arabidopsis thaliana seed germination.
    BMC Plant Biol., 2017. 17(1): p. 99
    [PMID:28587634]
  42. Xiao X,Cheng X,Yin K,Li H,Qiu JL
    Abscisic acid negatively regulates post-penetration resistance of Arabidopsis to the biotrophic powdery mildew fungus.
    Sci China Life Sci, 2017. 60(8): p. 891-901
    [PMID:28702742]
  43. Horstman A, et al.
    The BABY BOOM Transcription Factor Activates the LEC1-ABI3-FUS3-LEC2 Network to Induce Somatic Embryogenesis.
    Plant Physiol., 2017. 175(2): p. 848-857
    [PMID:28830937]
  44. Hanano A,Almousally I,Shaban M,Murphy DJ
    Arabidopsis plants exposed to dioxin result in a WRINKLED seed phenotype due to 20S proteasomal degradation of WRI1.
    J. Exp. Bot., 2018. 69(7): p. 1781-1794
    [PMID:29394403]
  45. Cheng Y,Zhang X,Sun T,Tian Q,Zhang WH
    Glutamate Receptor Homolog3.4 is Involved in Regulation of Seed Germination Under Salt Stress in Arabidopsis.
    Plant Cell Physiol., 2018. 59(5): p. 978-988
    [PMID:29432559]
  46. Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
    HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 600-619
    [PMID:29475938]