![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Oropetium_20150105_26940A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 142aa MW: 15582.6 Da PI: 5.8059 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177.2 | 1.5e-55 | 17 | 112 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ Oropetium_20150105_26940A 17 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRR 100 89********************************************************************************** PP NF-YB 86 ylkkyrelegek 97 yl+kyre+eg++ Oropetium_20150105_26940A 101 YLHKYREVEGDR 112 **********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-50 | 14 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.9E-39 | 19 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.2E-27 | 22 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-17 | 50 | 68 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-17 | 69 | 87 | No hit | No description |
PRINTS | PR00615 | 1.3E-17 | 88 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MADQPDGRPG AAADEIKEQD RLLPIANVGR IMKQILPPNA KISKEAKETM QECVSEFISF 60 VTGEASDKCH KEKRKTVNGD DVCWAFGALG FDDYVDPMRR YLHKYREVEG DRAAAAASSR 120 GPPPTLAPGL LDRAGPNYFC SP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-43 | 16 | 107 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Oropetium_20150105_26940A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU970198 | 1e-138 | EU970198.1 Zea mays clone 342117 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015635864.1 | 5e-69 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_015635872.1 | 5e-69 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 2e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0D3EYD4 | 1e-67 | A0A0D3EYD4_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0JTD0 | 2e-67 | A0A0E0JTD0_ORYPU; Uncharacterized protein | ||||
TrEMBL | A0A0E0N7B5 | 1e-67 | A0A0E0N7B5_ORYRU; Uncharacterized protein | ||||
TrEMBL | I1NUZ7 | 1e-67 | I1NUZ7_ORYGL; Uncharacterized protein | ||||
TrEMBL | Q942Y5 | 1e-67 | Q942Y5_ORYSJ; HAP3 subunit of HAP complex | ||||
STRING | ORUFI01G46550.1 | 2e-68 | (Oryza rufipogon) | ||||
STRING | OS01T0935200-01 | 2e-68 | (Oryza sativa) | ||||
STRING | OPUNC01G42210.1 | 3e-68 | (Oryza punctata) | ||||
STRING | ORGLA01G0368700.1 | 2e-68 | (Oryza glaberrima) | ||||
STRING | OBART01G43130.1 | 2e-68 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-58 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Oropetium_20150105_26940A |
Publications ? help Back to Top | |||
---|---|---|---|
|