 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Oropetium_20150105_18199A |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
Family |
CPP |
Protein Properties |
Length: 75aa MW: 8337.75 Da PI: 8.664 |
Description |
CPP family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Oropetium_20150105_18199A | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | TCR | 49.6 | 7.7e-16 | 31 | 66 | 4 | 39 |
TCR 4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39
++C+Ckks ClkkYC+Cf+ ++ Cs +CkCedCkN
Oropetium_20150105_18199A 31 RKCTCKKSACLKKYCDCFQGKAGCSINCKCEDCKNP 66
69*********************************6 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}. |
Best hit in Arabidopsis thaliana ? help
Back to Top |
Hit ID |
E-value |
Description |
AT3G22780.1 | 8e-17 | Tesmin/TSO1-like CXC domain-containing protein |
Publications
? help Back to Top |
- Lu T,Dou Y,Zhang C
Fuzzy clustering of CPP family in plants with evolution and interaction analyses. BMC Bioinformatics, 2013. 14 Suppl 13: p. S10 [PMID:24268301] - Xie W, et al.
Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach. Front Plant Sci, 2015. 6: p. 829 [PMID:26528302] - Wang W,Sijacic P,Xu P,Lian H,Liu Z
Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054 [PMID:29535223]
|