 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Oropetium_20150105_16100A |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
Family |
NF-YB |
Protein Properties |
Length: 122aa MW: 13467.5 Da PI: 5.216 |
Description |
NF-YB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Oropetium_20150105_16100A | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NF-YB | 142.2 | 1.3e-44 | 32 | 116 | 2 | 86 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
reqd+++Pian++rim++vlP +aki+++ake+vqecvsefisfvt+ea+d+c+ e+rkt++++d+lwa+ +lGf+dyv pl++
Oropetium_20150105_16100A 32 REQDQLMPIANMVRIMRRVLPPHAKIADNAKEVVQECVSEFISFVTGEANDRCRGEHRKTVTAEDVLWAMDHLGFDDYVGPLRA 115
89*********************************************************************************9 PP
NF-YB 86 y 86
y
Oropetium_20150105_16100A 116 Y 116
9 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0005634 | Cellular Component | nucleus |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0046982 | Molecular Function | protein heterodimerization activity |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Publications
? help Back to Top |
- Jia H,McCarty DR,Suzuki M
Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression. Plant Physiol., 2013. 163(3): p. 1293-305 [PMID:24043445] - Kim HU, et al.
Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. FEBS Open Bio, 2013. 4: p. 25-32 [PMID:24363987] - Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants. Mol Plant, 2017. 10(4): p. 645-648 [PMID:27871811] - Li D, et al.
MYB89 Transcription Factor Represses Seed Oil Accumulation. Plant Physiol., 2017. 173(2): p. 1211-1225 [PMID:27932421] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] - Han JD, et al.
Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program. Front Plant Sci, 2017. 8: p. 439 [PMID:28421087]
|