PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9290.37 Da PI: 6.884

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_15176A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.4	6.1e-32	19	73	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 v+Y+eC++NhAa++Gg+avDGC+Efm+ g+egta+al CaACgCHR+FHRrev+ Oropetium_20150105_15176A 19 VVHYRECQRNHAAAIGGYAVDGCREFMAL-GAEGTAEALLCAACGCHRSFHRREVV 73 699***********************9.999******************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-10	16	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	5.2E-30	20	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	6.4E-26	21	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.889	22	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGPKQEANGT AARKETKAVV HYRECQRNHA AAIGGYAVDG CREFMALGAE GTAEALLCAA 60 CGCHRSFHRR EVVEPADCDC SSTTTTSG*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_15176A

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025808589.1	2e-44	mini zinc finger protein 1-like
Refseq	XP_025827869.1	2e-44	mini zinc finger protein 1-like
Swissprot	B8BIU8	3e-30	MIF1_ORYSI; Mini zinc finger protein 1
Swissprot	Q2RB28	3e-30	MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBL	A0A270R7F7	5e-43	A0A270R7F7_9POAL; Uncharacterized protein
STRING	Si027403m	2e-42	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	3e-16	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_15176A

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]