![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORUFI05G20710.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 85aa MW: 10046.4 Da PI: 6.5049 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 84 | 1.8e-26 | 15 | 61 | 49 | 95 |
NF-YB 49 easdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 asdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre+e ORUFI05G20710.1 15 RASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREMEM 61 69*******************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-22 | 15 | 68 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.1E-5 | 15 | 37 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.42E-17 | 15 | 67 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.4E-12 | 20 | 38 | No hit | No description |
PRINTS | PR00615 | 1.4E-12 | 39 | 57 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MRCDWVFVVV GQHYRASDKC QREKRKTING DDLLWAMATL GFEDYIEPLK VYLQKYREME 60 MGQQAAYNQG MGYMQPQYHN GDVSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-18 | 16 | 58 | 51 | 93 | NF-YB |
4awl_B | 2e-18 | 16 | 58 | 52 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-18 | 16 | 58 | 52 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC108500 | 3e-92 | AC108500.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1280_A04, complete sequence. | |||
GenBank | AP014961 | 3e-92 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012613 | 3e-92 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001106052.2 | 9e-40 | nuclear transcription factor Y subunit B | ||||
Refseq | XP_020394778.1 | 9e-40 | nuclear transcription factor Y subunit B isoform X1 | ||||
Refseq | XP_020394779.1 | 9e-40 | nuclear transcription factor Y subunit B isoform X1 | ||||
Refseq | XP_020394780.1 | 9e-40 | nuclear transcription factor Y subunit B isoform X1 | ||||
Refseq | XP_020394781.1 | 9e-40 | nuclear transcription factor Y subunit B isoform X1 | ||||
Swissprot | P25209 | 7e-41 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A0E0PNM9 | 3e-58 | A0A0E0PNM9_ORYRU; Uncharacterized protein | ||||
STRING | ORUFI05G20710.1 | 6e-59 | (Oryza rufipogon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-28 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|