PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ORUFI01G46540.1

Organism

Oryza rufipogon

Taxonomic ID

4529

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NF-YB

Protein Properties

Length: 178aa MW: 18643.4 Da PI: 6.7794

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ORUFI01G46540.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	135	2.3e-42	35	126	3	94
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 qd++lPianv+rimk lP +akisk aket+qec++efisfvt+eas++c+re+r t +gdd+++a+ +lG+++y+++++ yl++yre e ORUFI01G46540.1 35 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRETGDGDDVCHAMRSLGLDHYADAMHRYLQRYREGE 126 69***************************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.4E-38	32	131	IPR009072	Histone-fold
SuperFamily	SSF47113	1.1E-29	36	137	IPR009072	Histone-fold
Pfam	PF00808	2.5E-20	40	103	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	6.7E-11	67	85	No hit	No description
PROSITE pattern	PS00685	0	70	86	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	6.7E-11	86	104	No hit	No description
PRINTS	PR00615	6.7E-11	105	123	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MQGLPRASSS STSASRDRDG GDGDGGGGGV TMTNGQDNLL PIANVGRIMK DGLPPQAKIS 60 KRAKETIQEC ATEFISFVTG EASERCRRER RETGDGDDVC HAMRSLGLDH YADAMHRYLQ 120 RYREGEELAA SLNSSSSAAA AAAAAAAAGS RGGGAIQIDV RAELSIFRSG NNQGRPNN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-36	36	124	4	92	Transcription factor HapC (Eurofung)
4g92_B	1e-36	36	124	4	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012609	0.0	CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025878241.1	2e-83	nuclear transcription factor Y subunit B-4
Swissprot	O04027	2e-40	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
Swissprot	O82248	5e-40	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
Swissprot	Q75IZ7	2e-39	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A0E0N7B4	1e-125	A0A0E0N7B4_ORYRU; Uncharacterized protein
STRING	ORUFI01G46540.1	1e-126	(Oryza rufipogon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2917	38	87

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	1e-35	nuclear factor Y, subunit B4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]