![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORGLA12G0042500.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 103aa MW: 11974.5 Da PI: 8.7848 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.7 | 2.6e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ ++q+G g+W++ ++ g+ R++k+c++rw +yl ORGLA12G0042500.1 14 KGAWTKEEDQRLIAHINQHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 25.6 | 2.9e-08 | 67 | 90 | 1 | 25 |
TSSS-HHHHHHHHHHHHHTTTT-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWk 25 rg++T eEdel+++++++lG++ W+ ORGLA12G0042500.1 67 RGNFTDEEDELIIKLHELLGNK-WS 90 89********************.*7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.721 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 8.1E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.59E-25 | 15 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.30E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 6.713 | 62 | 103 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-13 | 65 | 91 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.4E-6 | 67 | 90 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIN QHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TDEEDELIIK LHELLGNKWS XXXXXXXXXX XXX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-19 | 13 | 90 | 26 | 102 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | ORGLA12G0042500.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK063027 | 1e-149 | AK063027.1 Oryza sativa Japonica Group cDNA clone:001-110-B12, full insert sequence. | |||
GenBank | D88618 | 1e-149 | D88618.1 Oryza sativa mRNA for OSMYB2, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015618922.1 | 4e-61 | myb-related protein 308 | ||||
Swissprot | Q9SZP1 | 3e-57 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A0E0REG7 | 3e-60 | A0A0E0REG7_ORYRU; Uncharacterized protein | ||||
STRING | ORUFI12G05190.1 | 5e-61 | (Oryza rufipogon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 1e-59 | myb domain protein 4 |