 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
ORGLA02G0218900.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
Family |
MYB_related |
Protein Properties |
Length: 89aa MW: 10189.7 Da PI: 9.9316 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
ORGLA02G0218900.1 | genome | AGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 52.3 | 1.4e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
ORGLA02G0218900.1 15 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
678*******************************************97 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | EU837249 | 1e-146 | EU837249.1 Oryza sativa Japonica Group clone KCS157B05 ATMYB4-like protein mRNA, complete cds. |