![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORGLA01G0368600.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 176aa MW: 18585.5 Da PI: 8.4951 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 144.5 | 2.5e-45 | 35 | 126 | 3 | 94 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 qd++lPianv+rimk lP +akisk aket+qec++efisfvt+eas++c+re+rkt+ngdd+++a+ +lG+++y+++++ yl++yre e ORGLA01G0368600.1 35 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRKTVNGDDICHAMRSLGLDHYADAMHRYLQRYREGE 126 69***************************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.6E-42 | 32 | 131 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-33 | 36 | 137 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-24 | 40 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-14 | 67 | 85 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.2E-14 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 2.2E-14 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MQGLPRASSS STSASRDRDG GDGDGGGGGV TMTNGQDNLL PIANVGRIMK DGLPPQAKIS 60 KRAKETIQEC ATEFISFVTG EASERCRRER RKTVNGDDIC HAMRSLGLDH YADAMHRYLQ 120 RYREGEELAA SLNSSSSAAA TAAAAAGSRG GGAIQIDVRA ELSIFRSGNN QGRPNN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-39 | 36 | 124 | 4 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-39 | 36 | 124 | 4 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | ORGLA01G0368600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012609 | 0.0 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025878241.1 | 2e-85 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O04027 | 5e-43 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A0D3EYD3 | 1e-125 | A0A0D3EYD3_9ORYZ; Uncharacterized protein | ||||
TrEMBL | I1NUZ6 | 1e-125 | I1NUZ6_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA01G0368600.1 | 1e-125 | (Oryza glaberrima) | ||||
STRING | OBART01G43120.1 | 1e-125 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 2e-44 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|