![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OMERI05G17070.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 134aa MW: 14636.4 Da PI: 6.5218 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 154.7 | 1.6e-48 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre+eg++ OMERI05G17070.1 1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREMEGDS 81 9******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.1E-44 | 1 | 89 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-21 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.31E-32 | 1 | 85 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 6.6E-23 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.6E-23 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 6.6E-23 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF 60 EDYIEPLKVY LQKYREMEGD SKLTAKAGDG SVKKDVLGSH GGSSSSAQGM GQQAAYNQGM 120 GYMQPQYHNG DVSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-40 | 1 | 76 | 18 | 93 | NF-YB |
4awl_B | 2e-40 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-40 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB095439 | 0.0 | AB095439.1 Oryza sativa Japonica Group OsHAP3B mRNA for HAP3, partial cds. | |||
GenBank | AK100811 | 0.0 | AK100811.1 Oryza sativa Japonica Group cDNA clone:J023121O11, full insert sequence. | |||
GenBank | AY224530 | 0.0 | AY224530.1 Oryza sativa (japonica cultivar-group) isolate 21744 CCAAT-binding transcription factor-like protein mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015639303.1 | 7e-96 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_015639304.1 | 7e-96 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_015639305.1 | 7e-96 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q60EQ4 | 6e-97 | NFYB3_ORYSJ; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0D3G8P5 | 3e-95 | A0A0D3G8P5_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0DSL9 | 3e-95 | A0A0E0DSL9_9ORYZ; Uncharacterized protein | ||||
TrEMBL | B7EQX8 | 2e-94 | B7EQX8_ORYSJ; cDNA clone:J023121O11, full insert sequence | ||||
TrEMBL | I1PWE8 | 2e-94 | I1PWE8_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA05G0169600.1 | 3e-95 | (Oryza glaberrima) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 9e-58 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|