PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G05890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 103aa    MW: 11079.5 Da    PI: 8.2071
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G05890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.41.4e-2150871451
                     HHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF 14 skRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     +kRrng+lKKA+ELS  Cdaeva+i+fss+g+lyeys+
  OMERI05G05890.1 50 IKRRNGLLKKAYELSMICDAEVALIVFSSRGHLYEYSN 87
                     69**********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.3854089IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-174388IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-174589IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-185166IPR002100Transcription factor, MADS-box
PfamPF003192.9E-175185IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-186687IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MHIYNEQEAE PSTGLMMPEP APAASPGSGS SGGSGSVGAE KSGSRGKIEI KRRNGLLKKA  60
YELSMICDAE VALIVFSSRG HLYEYSNNRY CIPLPLFSSR NLN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269|PubMed:16326928}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1359203e-71AC135920.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0015G13, complete sequence.
GenBankAP0149613e-71AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126133e-71CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881631.16e-35MADS-box transcription factor 58 isoform X2
SwissprotQ2V0P11e-36MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0E0DN623e-68A0A0E0DN62_9ORYZ; Uncharacterized protein
STRINGOMERI05G05680.14e-69(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.22e-20MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  4. Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
    Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58.
    Plant Sci., 2012. 183: p. 183-9
    [PMID:22195592]
  5. Yun D, et al.
    OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice.
    Mol Plant, 2013. 6(3): p. 743-56
    [PMID:23300256]
  6. Yan D, et al.
    Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development.
    Plant J., 2015. 82(1): p. 12-24
    [PMID:25647350]
  7. Zheng M, et al.
    DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa).
    New Phytol., 2015. 206(4): p. 1476-90
    [PMID:25675970]
  8. Chen R, et al.
    A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58.
    Mol Plant, 2015. 8(7): p. 1069-89
    [PMID:25684654]
  9. Hu Y, et al.
    Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development.
    Mol Plant, 2015. 8(9): p. 1366-84
    [PMID:25917758]