PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G05000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 92aa    MW: 10392.7 Da    PI: 7.3656
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G05000.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH21.73.6e-0720591554
                     HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     +i +  ++L++llP+a   ++ ++  + +L+++++YI+sL
  OMERI03G05000.2 20 QISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCNYIRSL 59
                     789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.3E-8478IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.813559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474595.63E-91981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.6E-42059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSRQ SGSSRITDEQ ISDLVSKLQD LLPEARLRSN DRVPSSRVLQ ETCNYIRSLH  60
QEVDDLSERL SELLATSDMS SAQAAIIRSL LM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0695691e-152AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629922.18e-57transcription factor ILI6 isoform X7
SwissprotB8APB57e-58ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR27e-58ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A0D3FEE42e-55A0A0D3FEE4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CVV12e-55A0A0E0CVV1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GHG82e-55A0A0E0GHG8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NQC52e-55A0A0E0NQC5_ORYRU; Uncharacterized protein
TrEMBLI1P8152e-55I1P815_ORYGL; Uncharacterized protein
STRINGOMERI03G05010.13e-56(Oryza meridionalis)
STRINGOS03T0171300-013e-56(Oryza sativa)
STRINGORGLA03G0051100.13e-56(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.16e-34bHLH family protein