![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OMERI01G33390.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 180aa MW: 19311.8 Da PI: 6.1178 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 176.1 | 3.5e-55 | 36 | 129 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yv+plk+yl+kyre + OMERI01G33390.2 36 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREGD 129 69*****************************************************************************************965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.4E-52 | 34 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.04E-39 | 39 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-28 | 42 | 106 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.7E-22 | 70 | 88 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 73 | 89 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.7E-22 | 89 | 107 | No hit | No description |
PRINTS | PR00615 | 2.7E-22 | 108 | 126 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MVCAVMMMDL GFLEGGAGMA DAGHDESGSP PRSGGVREQD RFLPIANISR IMKKAVPANG 60 KIAKDAKETL QECVSEFISF VTSEASDKCQ KEKRKTINGE DLLFAMGTLG FEEYVDPLKI 120 YLHKYREGDS KLSSKAGDGS VKKDTIGPHS GASSSSAQGM VGAYTQGMGY MQPQYHNGDT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-48 | 36 | 127 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-48 | 36 | 127 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB095438 | 0.0 | AB095438.1 Oryza sativa Japonica Group OsHAP3A mRNA for HAP3, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015611518.2 | 1e-118 | nuclear transcription factor Y subunit B-2 isoform X1 | ||||
Swissprot | Q5QMG3 | 1e-119 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | A0A0E0C9Y1 | 1e-131 | A0A0E0C9Y1_9ORYZ; Uncharacterized protein | ||||
STRING | OGLUM01G40190.1 | 1e-121 | (Oryza glumipatula) | ||||
STRING | ORUFI01G39650.2 | 1e-121 | (Oryza rufipogon) | ||||
STRING | ONIVA01G41260.2 | 1e-121 | (Oryza nivara) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-65 | nuclear factor Y, subunit B8 |