PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART08G17810.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 144aa MW: 15736 Da PI: 10.696 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.1 | 3e-16 | 69 | 112 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ OBART08G17810.1 69 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKK 112 79***************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-12 | 65 | 131 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.944 | 67 | 112 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 3.15E-23 | 69 | 115 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-15 | 69 | 112 | No hit | No description |
SuperFamily | SSF57959 | 1.69E-11 | 69 | 112 | No hit | No description |
Pfam | PF00170 | 1.1E-13 | 69 | 112 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 72 | 87 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MGNGLMSGVA GIGGGAITVA PVDTSVGQMD SAGKGDGDLS SPMAPVPYPF EGVIRGRRSG 60 GNVEKVVERR QRRMIKNRES AARSRARKQA YTMELEAEVQ KLKEQNMELQ KKQVLEAVNN 120 PYGQKKRCLR RTLTGPWNVG EIHI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB023288 | 0.0 | AB023288.1 Oryza sativa Japonica Group mRNA for TRAB1, complete cds. | |||
GenBank | AY323482 | 0.0 | AY323482.1 Oryza sativa (japonica cultivar-group) bZIP transcription factor (aba1) mRNA, complete cds. | |||
GenBank | KT037117 | 0.0 | KT037117.1 Oryza sativa Indica Group cultivar Nonabokra abscisic acid inducible bZIP protein (TRAB1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015650926.1 | 2e-78 | bZIP transcription factor TRAB1 | ||||
Swissprot | Q6ZDF3 | 2e-79 | TRAB1_ORYSJ; bZIP transcription factor TRAB1 | ||||
TrEMBL | A0A0D3H1A0 | 1e-100 | A0A0D3H1A0_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0ID92 | 6e-98 | A0A0E0ID92_ORYNI; Uncharacterized protein | ||||
STRING | ONIVA08G19830.1 | 1e-98 | (Oryza nivara) | ||||
STRING | OBART08G17810.1 | 1e-101 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP706 | 38 | 147 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G19290.1 | 3e-37 | ABRE binding factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|