![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART06G01950.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 248aa MW: 27208.2 Da PI: 6.6796 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.3 | 3e-53 | 11 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++ ++ + +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+ OBART06G01950.1 11 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQErcRIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKA 103 69****************************.9***************953444443456*********************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl OBART06G01950.1 104 IYS-SSNRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139 ***.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-55 | 7 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.789 | 11 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-28 | 12 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009809 | Biological Process | lignin biosynthetic process | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0010047 | Biological Process | fruit dehiscence | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MSISVNGQSV VPPGFRFHPT EEELLTYYLK KKVASERIDL DVIRDVDLNK LEPWDIQERC 60 RIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYSSSNR IGMRKTLVFY 120 KGRAPHGQKS DWIMHEYRLD DPSSASASVS VNLPSYYSSS SSSSSPYCSA ADASGIADWD 180 TLDRLAASYE LNGALSDVAS GKNMAGFFDV VDQPAGAAAF SSGDGDLWSL ARSVSSSLHA 240 DLTTMNNV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-47 | 8 | 164 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-47 | 8 | 164 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-47 | 8 | 164 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-47 | 8 | 164 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-47 | 8 | 165 | 17 | 174 | NAC domain-containing protein 19 |
3ulx_A | 1e-47 | 11 | 139 | 15 | 140 | Stress-induced transcription factor NAC1 |
4dul_A | 2e-47 | 8 | 164 | 14 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-47 | 8 | 164 | 14 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00321 | DAP | Transfer from AT2G46770 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT833124 | 0.0 | CT833124.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA241M20, full insert sequence. | |||
GenBank | CT833125 | 0.0 | CT833125.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI245A08, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015643041.1 | 1e-105 | NAC domain-containing protein 43 | ||||
Swissprot | Q84WP6 | 3e-93 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
TrEMBL | A0A0D3GCE0 | 0.0 | A0A0D3GCE0_9ORYZ; Uncharacterized protein | ||||
STRING | OBART06G01950.1 | 0.0 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1597 | 38 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46770.1 | 2e-80 | NAC family protein |