 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
OBART04G30090.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
| Family |
NF-YC |
| Protein Properties |
Length: 125aa MW: 13251.1 Da PI: 9.1825 |
| Description |
NF-YC family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| OBART04G30090.1 | genome | OGE | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NF-YC | 83.9 | 1.9e-26 | 54 | 116 | 37 | 99 |
NF-YC 37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
+mis eaPv++skacelfi elt r+w + e krrt++k d+aaav++td fdflvd+v d
OBART04G30090.1 54 RMISGEAPVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTAD 116
8**********************************************************9876 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AB288047 | 0.0 | AB288047.1 Oryza sativa Japonica Group OsHAP5G gene for HAP5 subunit of HAP complex, complete cds. |
| GenBank | AL606641 | 0.0 | AL606641.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0032F06, complete sequence. |
| GenBank | AP014960 | 0.0 | AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence. |
| Publications
? help Back to Top |
- Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Li S, et al.
HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis.
Plant Cell, 2014. 26(4): p. 1764-1780
[PMID:24728648] - Mei X, et al.
Identification and characterization of paternal-preferentially expressed gene NF-YC8 in maize endosperm.
Mol. Genet. Genomics, 2015. 290(5): p. 1819-31
[PMID:25851237] - Hwang YH, et al.
Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
Plant Cell Rep., 2016. 35(4): p. 857-65
[PMID:26754793] - Baud S, et al.
Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed.
Plant Physiol., 2016. 171(2): p. 1099-112
[PMID:27208266] - Liu X, et al.
The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
Nat Commun, 2016. 7: p. 12768
[PMID:27624486] - Myers ZA, et al.
NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
PLoS Genet., 2016. 12(9): p. e1006333
[PMID:27685091] - Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
Mol Plant, 2017. 10(4): p. 645-648
[PMID:27871811] - Tang Y, et al.
Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
Mol Plant, 2017. 10(2): p. 260-273
[PMID:27876642] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
Front Plant Sci, 2016. 7: p. 2045
[PMID:28119722] - Gnesutta N, et al.
CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
Plant Cell, 2017. 29(6): p. 1516-1532
[PMID:28526714]
|
