 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
OBART02G33770.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
| Family |
bZIP |
| Protein Properties |
Length: 144aa MW: 15630.9 Da PI: 10.5211 |
| Description |
bZIP family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| OBART02G33770.1 | genome | OGE | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 50.9 | 3.5e-16 | 87 | 135 | 5 | 53 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
+r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ +e+
OBART02G33770.1 87 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEML 135
79***************************************98877654 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Sequence ? help Back to Top |
| Protein Sequence Length: 144 aa
Download sequence Send
to blast |
MLFGQSNVFP PMVPPLSLGS GLVSGAVGHG GGGAASLVSP VRPVSSNGFG KMEGGDLSSL 60
SPSPVPYVFN GGLRGRKAPG IEKVVERRQR RMIKNRESAA RSRQRKQAYM MELEAEVAKL 120
KELNDELQKK QDEMLEQQKN EHTI
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator that mediates abscisic acid (ABA) signaling (PubMed:18931143, PubMed:19947981, PubMed:27424498, PubMed:27325665). Can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. Confers ABA-dependent drought and salinity tolerance (PubMed:18931143, PubMed:27325665). Binds specifically to the ABA-responsive elements (ABRE) in the promoter of target genes to mediate stress-responsive ABA signaling (PubMed:27325665, PubMed:27424498). {ECO:0000269|PubMed:18931143, ECO:0000269|PubMed:19947981, ECO:0000269|PubMed:27325665, ECO:0000269|PubMed:27424498}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Induced by abscisic acid (ABA) (PubMed:18315698, PubMed:18931143). Induced by drought, salt and osmotic stresses (PubMed:18931143). {ECO:0000269|PubMed:18315698, ECO:0000269|PubMed:18931143}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK072062 | 0.0 | AK072062.1 Oryza sativa Japonica Group cDNA clone:J013109E06, full insert sequence. |
| GenBank | KP779638 | 0.0 | KP779638.1 Oryza nivara OsbZIP23 (bZIP23) mRNA, complete cds. |
| Best hit in Arabidopsis thaliana ? help
Back to Top |
| Hit ID |
E-value |
Description |
| AT1G45249.1 | 6e-30 | abscisic acid responsive elements-binding factor 2 |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Xiang Y,Tang N,Du H,Ye H,Xiong L
Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.
Plant Physiol., 2008. 148(4): p. 1938-52
[PMID:18931143] - Shen J,Xie K,Xiong L
Global expression profiling of rice microRNAs by one-tube stem-loop reverse transcription quantitative PCR revealed important roles of microRNAs in abiotic stress responses.
Mol. Genet. Genomics, 2010. 284(6): p. 477-88
[PMID:20941508] - Luo C,Guo C,Wang W,Wang L,Chen L
Overexpression of a new stress-repressive gene OsDSR2 encoding a protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice.
Plant Cell Rep., 2014. 33(2): p. 323-36
[PMID:24247850] - Sakuraba Y, et al.
Rice ONAC106 Inhibits Leaf Senescence and Increases Salt Tolerance and Tiller Angle.
Plant Cell Physiol., 2015. 56(12): p. 2325-39
[PMID:26443376] - Hong Y,Zhang H,Huang L,Li D,Song F
Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
Front Plant Sci, 2016. 7: p. 4
[PMID:26834774] - Dey A,Samanta MK,Gayen S,Sen SK,Maiti MK
Enhanced Gene Expression Rather than Natural Polymorphism in Coding Sequence of the OsbZIP23 Determines Drought Tolerance and Yield Improvement in Rice Genotypes.
PLoS ONE, 2016. 11(3): p. e0150763
[PMID:26959651] - Zong W, et al.
Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.
Plant Physiol., 2016. 171(4): p. 2810-25
[PMID:27325665] - Dey A,Samanta MK,Gayen S,Maiti MK
The sucrose non-fermenting 1-related kinase 2 gene SAPK9 improves drought tolerance and grain yield in rice by modulating cellular osmotic potential, stomatal closure and stress-responsive gene expression.
BMC Plant Biol., 2016. 16(1): p. 158
[PMID:27411911] - Gui J, et al.
OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.
Dev. Cell, 2016. 38(2): p. 201-13
[PMID:27424498]
|
