 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
OBART02G09820.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
| Family |
BES1 |
| Protein Properties |
Length: 96aa MW: 10948.8 Da PI: 10.2918 |
| Description |
BES1 family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| OBART02G09820.1 | genome | OGE | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF822 | 121 | 1.7e-37 | 33 | 85 | 20 | 72 |
DUF822 20 RrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72
RrRRaiaakiyaGLRa+Gny lpk++DnneVlkALc+eAGw+ve+DGttyrk
OBART02G09820.1 33 RRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKV 85
9**************************************************85 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 5zd4_A | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AP004070 | 1e-103 | AP004070.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1705_E12. |
| GenBank | AP014958 | 1e-103 | AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence. |
