![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART01G43140.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13576.3 Da PI: 6.2307 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 155.3 | 1.1e-48 | 33 | 116 | 2 | 85 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ OBART01G43140.1 33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRR 116 89*******************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-45 | 27 | 118 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.54E-34 | 35 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-27 | 38 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.8E-13 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.8E-13 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 3.8E-13 | 104 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MADHHGDHHA DGHRRQQQLQ GEAADQAAAE IIKEQDRLLP IANVGRIMKQ ILPPNAKISK 60 EAKETMQECV SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDDY VDPMRRIYAS 120 I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-39 | 32 | 120 | 1 | 88 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-39 | 32 | 120 | 1 | 88 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB288038 | 0.0 | AB288038.1 Oryza sativa Japonica Group OsHAP3D gene for HAP3 subunit of HAP complex, complete cds. | |||
GenBank | AP003246 | 0.0 | AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12. | |||
GenBank | AP003266 | 0.0 | AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09. | |||
GenBank | AP014957 | 0.0 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012609 | 0.0 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015635864.1 | 1e-82 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_015635872.1 | 1e-82 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 6e-50 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0D3EYD5 | 1e-85 | A0A0D3EYD5_9ORYZ; Uncharacterized protein | ||||
STRING | OBART01G43140.1 | 2e-86 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-52 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|