![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART01G36280.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 189aa MW: 20752.5 Da PI: 6.9322 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.7 | 3e-57 | 18 | 114 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yv+plk+yl+kyre+e OBART01G36280.1 18 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREME 111 69******************************************************************************************** PP NF-YB 95 gek 97 g++ OBART01G36280.1 112 GDS 114 *97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.4E-54 | 16 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.88E-40 | 21 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.2E-28 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.0E-22 | 52 | 70 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.0E-22 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 3.0E-22 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MADAGHDESG SPPRSGGVRE QDRFLPIANI SRIMKKAVPA NGKIAKDAKE TLQECVSEFI 60 SFVTSEASDK CQKEKRKTIN GEDLLFAMGT LGFEEYVDPL KIYLHKYREM EGDSKLSSKA 120 GDGSVKKDTI GPHSGASSSS AQGMVGAYTQ GMGYMQPQSN FHILVVLQSF AFPYMYQVAQ 180 IYCKYPSIE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-48 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-48 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY332466 | 0.0 | AY332466.1 Oryza sativa (japonica cultivar-group) CCAAT-binding protein (CCB1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015611523.1 | 1e-113 | nuclear transcription factor Y subunit B-2 isoform X2 | ||||
Swissprot | Q5QMG3 | 1e-112 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | A0A0D3EVX8 | 1e-138 | A0A0D3EVX8_9ORYZ; Uncharacterized protein | ||||
TrEMBL | I1NSY2 | 1e-138 | I1NSY2_ORYGL; Uncharacterized protein | ||||
TrEMBL | Q7E0Y8 | 1e-138 | Q7E0Y8_ORYSJ; CCAAT-binding protein | ||||
STRING | ORGLA01G0297200.1 | 1e-139 | (Oryza glaberrima) | ||||
STRING | OBART01G36280.1 | 1e-139 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-68 | nuclear factor Y, subunit B10 |