PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB05G15280.1 | ||||||||
Common Name | LOC102714095 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 197aa MW: 21645 Da PI: 6.2648 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.5 | 3.6e-30 | 104 | 162 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver++ed ++v++tY g Hnh OB05G15280.1 104 LDDGFKWRKYGKKAVKNSPNPRNYYRCSTEGCNVKKRVERDREDHRYVITTYDGVHNHA 162 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.5E-32 | 92 | 164 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.96E-27 | 96 | 164 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.422 | 99 | 164 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.5E-34 | 104 | 163 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.9E-23 | 105 | 161 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MAASVGLNPE AFFSSSCSYS SSSSPFMASY GPELRAATTV AVEADFFGEL DFDYSLPAPV 60 FTGSGDEYPE NNKNIMMMCG NEEKITARVN GRIGFRMRSE VEILDDGFKW RKYGKKAVKN 120 SPNPRNYYRC STEGCNVKKR VERDREDHRY VITTYDGVHN HASPAAALQY AGDYYTSPPG 180 SAGSPPSAPY SAGSLLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-25 | 90 | 165 | 3 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-25 | 90 | 165 | 3 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB05G15280.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK066252 | 1e-102 | AK066252.1 Oryza sativa Japonica Group cDNA clone:J013052M10, full insert sequence. | |||
GenBank | CT832802 | 1e-102 | CT832802.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN033C24, full insert sequence. | |||
GenBank | HQ858875 | 1e-102 | HQ858875.1 Oryza sativa Japonica Group isolate UT1752 WRKY transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006654120.1 | 1e-145 | PREDICTED: probable WRKY transcription factor 51 | ||||
TrEMBL | J3M4K4 | 1e-144 | J3M4K4_ORYBR; Uncharacterized protein | ||||
STRING | OB05G15280.1 | 1e-145 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-39 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 102714095 |