![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf10260g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 86aa MW: 9530.3 Da PI: 10.0406 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 134.2 | 3.1e-42 | 19 | 86 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + veakG+nPGlivll++ggl+l fl+gny+lyvyaqk+lPP+kkkP+skkk+kre+lkqGv++PGe Niben101Scf10260g00003.1 19 ANDVEAKGFNPGLIVLLLIGGLVLAFLIGNYVLYVYAQKTLPPKKKKPLSKKKMKRERLKQGVSAPGE 86 6789***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 1.0E-4 | 20 | 86 | No hit | No description |
Pfam | PF04689 | 3.2E-39 | 22 | 86 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MEFSAPTLEE VEELNNNMAN DVEAKGFNPG LIVLLLIGGL VLAFLIGNYV LYVYAQKTLP 60 PKKKKPLSKK KMKRERLKQG VSAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018623407.1 | 1e-41 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 3e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A1U7WEN5 | 4e-40 | A0A1U7WEN5_NICSY; DNA-binding protein S1FA-like | ||||
STRING | XP_009590376.1 | 4e-41 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |