PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NAC

Protein Properties

Length: 148aa MW: 17618 Da PI: 9.4899

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf09658g00029.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	179.1	1.2e-55	6	133	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L k + +++ ewyfF +rd+ky++g r+nrat++gyW Niben101Scf09658g00029.1 6 LPPGFRFHPTDEELVNYYLKRKIHGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYW 89 79**************************.99**********84335556888*********************** PP NAM 84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k+tgkd++v s +++++g+kktLv+y+grap+g +tdWvmheyrl Niben101Scf09658g00029.1 90 KSTGKDRRVSS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133 ******9.8999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.79E-60	4	142	IPR003441	NAC domain
PROSITE profile	PS51005	55.786	6	148	IPR003441	NAC domain
Pfam	PF02365	5.7E-31	7	133	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG QEIELDIIPE VDLYKCEPWE LAEKSFLPSR 60 DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRAIGMKKT LVYYRGRAPQ 120 GIRTDWVMHE YRLDDKECDE ISSIQNRK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	4e-55	2	133	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009621552.1	1e-106	PREDICTED: NAC domain-containing protein 86 isoform X2
Refseq	XP_009790485.1	1e-106	PREDICTED: NAC domain-containing protein 74 isoform X2
Refseq	XP_016441522.1	1e-106	PREDICTED: NAC domain-containing protein 86-like isoform X2
Refseq	XP_016510515.1	1e-106	PREDICTED: NAC domain-containing protein 86-like isoform X2
Swissprot	Q9FFI5	4e-81	NAC86_ARATH; NAC domain-containing protein 86
TrEMBL	A0A1S3XPE1	1e-105	A0A1S3XPE1_TOBAC; NAC domain-containing protein 86-like isoform X2
TrEMBL	A0A1S4DAP2	1e-105	A0A1S4DAP2_TOBAC; NAC domain-containing protein 86-like isoform X2
TrEMBL	A0A1U7XVJ6	1e-105	A0A1U7XVJ6_NICSY; NAC domain-containing protein 74 isoform X2
STRING	XP_009790484.1	1e-105	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4621	24	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G17730.1	1e-103	NAC domain containing protein 57

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]