PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf08504g02005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 117aa MW: 13323.3 Da PI: 10.5129 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 91.4 | 1.9e-28 | 40 | 102 | 2 | 64 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltg 64 a kk rhski T+ g+Rd R+Rls+++a+++F Lqd LGfdk+skt eWLl ++k a+ e ++ Niben101Scf08504g02005.1 40 AYKKNRHSKINTAHGPRDQRMRLSLDVARKLFNLQDFLGFDKASKTMEWLLIKSKSAVNEVVR 102 789*******************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 28.55 | 42 | 100 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 1.9E-30 | 42 | 103 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MAAYSNKDIV ISSTNQDPEE VEIQGIFKNR KGDNKRVAAA YKKNRHSKIN TAHGPRDQRM 60 RLSLDVARKL FNLQDFLGFD KASKTMEWLL IKSKSAVNEV VRGIKAAIEI ENKISNY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019244778.1 | 5e-56 | PREDICTED: transcription factor DICHOTOMA-like | ||||
Swissprot | Q9SBV9 | 4e-23 | CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment) | ||||
TrEMBL | A0A1J6JE48 | 1e-54 | A0A1J6JE48_NICAT; Transcription factor teosinte branched 1 | ||||
STRING | XP_009787900.1 | 6e-53 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2482 | 22 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G67260.2 | 7e-24 | TCP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|