PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf07812g00015.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 235aa MW: 26717.1 Da PI: 9.8532 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.4 | 1.4e-31 | 43 | 92 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Niben101Scf07812g00015.1 43 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 92 79***********************************************8 PP | |||||||
2 | K-box | 71.5 | 2.5e-24 | 111 | 178 | 4 | 71 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 s++ s +ea+a+++qqe++kL+ +i nLq+++R++lGe+L L+l++L++Leq++ek+++kiRskK Niben101Scf07812g00015.1 111 SNTGSISEANAQYYQQEASKLRGQIGNLQNQNRNMLGESLAALTLRDLKNLEQRIEKGISKIRSKKIA 178 4445599**********************************************************964 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-41 | 35 | 94 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.669 | 35 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.17E-46 | 36 | 112 | No hit | No description |
SuperFamily | SSF55455 | 3.01E-33 | 36 | 108 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 37 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-33 | 37 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.5E-27 | 44 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-33 | 57 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-33 | 72 | 93 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-16 | 119 | 177 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.896 | 121 | 235 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MDASYMGTSF AGNFQSEGME FQSDLTREIS PQRKLGRGKI EIKRIENTTN RQVTFCKRRN 60 GLLKKAYELS VLCDAEVALI VFSSRGRLYE YANNSVKATI ERYKKACSDS SNTGSISEAN 120 AQYYQQEASK LRGQIGNLQN QNRNMLGESL AALTLRDLKN LEQRIEKGIS KIRSKKIAET 180 ERAQQQQQMN LMPGSSSYEL VPPPQQFDTR NYLQVNGLQS NNHYIRQDQP SLQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 1e-20 | 35 | 103 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 35 | 103 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 35 | 103 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 35 | 103 | 1 | 69 | MEF2C |
6byy_A | 1e-20 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 1e-20 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 1e-20 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 1e-20 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019233178.1 | 1e-148 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_019233179.1 | 1e-148 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_019233180.1 | 1e-148 | PREDICTED: floral homeotic protein AGAMOUS isoform X3 | ||||
Swissprot | Q43585 | 1e-143 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A1J6KBS9 | 1e-147 | A0A1J6KBS9_NICAT; Floral homeotic protein agamous | ||||
STRING | XP_009802759.1 | 1e-142 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 2e-98 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|