PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf07044g02004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 73aa MW: 8681.23 Da PI: 7.4404 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 23.2 | 1.2e-07 | 43 | 72 | 14 | 43 |
HHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS Homeobox 14 eLeelFeknrypsaeereeLAkklgLterq 43 +L e F++n+yp+ +++e+L+k+lgLt q Niben101Scf07044g02004.1 43 RLYESFKENQYPDCDAKEKLSKELGLTAHQ 72 6999**********************9765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-6 | 43 | 72 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.84E-5 | 43 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 8.41E-6 | 43 | 72 | No hit | No description |
Pfam | PF00046 | 5.0E-5 | 43 | 72 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MGEEKTVCHL RRHQLLILEF LLIKDCDFVF TLVMLVFKNF GMRLYESFKE NQYPDCDAKE 60 KLSKELGLTA HQK |