![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf06435g02004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 120aa MW: 13713.9 Da PI: 8.4871 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 117.6 | 7.2e-37 | 5 | 105 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 +CaaCk lrr+C+ +C++ pyfp ++p++f +vh+++Gasnv k+l++++e++r d+++sl eA +r++dPvyG+vg+++ l++ Niben101Scf06435g02004.1 5 RCAACKQLRRRCPLNCIFLPYFPPNNPQRFSYVHRIYGASNVGKMLQQVQEHQRADVADSLHLEAYCRIKDPVYGCVGIVTLLHE 89 6************************************************************************************ PP DUF260 86 qleqlkaelallkeel 101 ++ +++ +la++++e+ Niben101Scf06435g02004.1 90 EIYHVQCQLAKVQAEI 105 ***********99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.386 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.1E-36 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MTSSRCAACK QLRRRCPLNC IFLPYFPPNN PQRFSYVHRI YGASNVGKML QQVQEHQRAD 60 VADSLHLEAY CRIKDPVYGC VGIVTLLHEE IYHVQCQLAK VQAEINLLKA QGQVQGELQQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-34 | 2 | 116 | 8 | 121 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-34 | 2 | 116 | 8 | 121 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009798305.1 | 9e-81 | PREDICTED: LOB domain-containing protein 24-like | ||||
Refseq | XP_016455407.1 | 9e-81 | PREDICTED: LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 4e-45 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A1S3YTT8 | 2e-79 | A0A1S3YTT8_TOBAC; LOB domain-containing protein 24-like | ||||
TrEMBL | A0A1U7YHK4 | 2e-79 | A0A1U7YHK4_NICSY; LOB domain-containing protein 24-like | ||||
STRING | XP_009798305.1 | 4e-80 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5277 | 20 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-47 | LOB domain-containing protein 24 |