PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf05519g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 130aa MW: 14584.6 Da PI: 10.2737 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 50.4 | 4.8e-16 | 81 | 125 | 4 | 48 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 ++r rrk+kNRe+A rsR+RK+a++ eL +kv Le+eN++Lkke Niben101Scf05519g00002.1 81 DRRLRRKIKNRESAARSRARKQAYQNELVTKVSLLEEENMKLKKE 125 789****************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.8E-7 | 78 | 129 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.76 | 80 | 125 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.5E-14 | 81 | 125 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.25E-11 | 82 | 125 | No hit | No description |
CDD | cd14707 | 5.58E-17 | 82 | 127 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 2.0E-12 | 82 | 125 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 85 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MNDQERKPTL GETTLEDYLV KAGLFSADAS LGHTMSLDNP TAVQNFVPPI GLSPSPSIDA 60 LSDTPFSGRK RDATDIDKTL DRRLRRKIKN RESAARSRAR KQAYQNELVT KVSLLEEENM 120 KLKKEKIGVR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019258990.1 | 1e-75 | PREDICTED: LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 2, partial | ||||
Swissprot | Q9C5Q2 | 3e-24 | AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3 | ||||
TrEMBL | A0A314LG83 | 8e-75 | A0A314LG83_NICAT; Abscisic acid-insensitive 5-like protein 2 | ||||
STRING | XP_009588379.1 | 8e-78 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12596 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G41070.3 | 3e-22 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|