PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf04514g03005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 119aa MW: 13918.9 Da PI: 4.9477 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 132.1 | 2.9e-41 | 1 | 104 | 35 | 138 |
Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgn 119 +l++a+a+++r+ydW++ q+f+l + e++++++l+ k+sceffh p +++++eGkvrk+l+ve lpdGsG f+nlsv+n+l++ + Niben101Scf04514g03005.1 1 MLQFAPAAGVRQYDWGRMQVFSLFVIEMGSFINLGEKDSCEFFHYPNKEKGDEGKVRKVLRVELLPDGSGRFFNLSVQNKLINLD 85 89*********************************************************************************** PP Whirly 120 esfsvPvskaefavlrsll 138 e++++P ++ efavl ++ Niben101Scf04514g03005.1 86 ENIYIPATEEEFAVLVFAF 104 ***************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF08536 | 1.9E-36 | 1 | 100 | IPR013742 | Plant transcription factor |
SuperFamily | SSF54447 | 7.85E-36 | 1 | 106 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 1.2E-36 | 1 | 105 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MLQFAPAAGV RQYDWGRMQV FSLFVIEMGS FINLGEKDSC EFFHYPNKEK GDEGKVRKVL 60 RVELLPDGSG RFFNLSVQNK LINLDENIYI PATEEEFAVL VFAFNRIEVW SPCRRERDY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016474450.1 | 9e-57 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
Refseq | XP_019257017.1 | 1e-56 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
Swissprot | Q9LL85 | 4e-56 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A1J6IDX2 | 3e-55 | A0A1J6IDX2_NICAT; Single-stranded dna-binding protein why1, chloroplastic | ||||
TrEMBL | A0A1S4ACQ8 | 2e-55 | A0A1S4ACQ8_TOBAC; single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
STRING | XP_009758353.1 | 2e-55 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7731 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02740.2 | 1e-54 | ssDNA-binding transcriptional regulator |