PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf03653g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 195aa MW: 21624 Da PI: 9.9731 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 103.7 | 1.1e-32 | 18 | 71 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ Niben101Scf03653g00002.1 18 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 71 9****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 6.45E-16 | 15 | 72 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.6E-29 | 16 | 71 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.9E-24 | 18 | 71 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.2E-7 | 19 | 70 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MRSRFLPKLP AKRSMRAPRM RWTSTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA 60 HVKSHLQMYR TVKTTDKPAA SSGQSDGSGE DDLTTIGSTG AGDRSTGLCR FTDQRGASDG 120 SVQPESDYPS TANPTLWSNS SSSRREGWLQ PNSNDANGLR SPFFPSQQRS GHQIEKNPSL 180 EFTLGRPDWV EKERD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 3e-17 | 19 | 73 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 3e-17 | 19 | 73 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 3e-17 | 19 | 73 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 3e-17 | 19 | 73 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009772639.1 | 1e-131 | PREDICTED: transcription repressor KAN1 isoform X1 | ||||
Refseq | XP_016437591.1 | 1e-131 | PREDICTED: transcription repressor KAN1-like isoform X2 | ||||
Swissprot | Q93WJ9 | 3e-64 | KAN1_ARATH; Transcription repressor KAN1 | ||||
TrEMBL | A0A1S3XCE6 | 1e-130 | A0A1S3XCE6_TOBAC; transcription repressor KAN1-like isoform X2 | ||||
TrEMBL | A0A1U7WDB4 | 1e-130 | A0A1U7WDB4_NICSY; transcription repressor KAN1 isoform X1 | ||||
STRING | XP_009772639.1 | 1e-131 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2468 | 23 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G16560.1 | 9e-62 | G2-like family protein |