PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf03502g01003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 120aa MW: 13736.9 Da PI: 9.2942 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 53.1 | 5.7e-17 | 43 | 103 | 35 | 97 |
EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 +++l+++s rsW vk+++ + lt+GWkeFv +n+Lk+gD++vF++++rs++ ++v +f Niben101Scf03502g01003.1 43 DVILQNSSTRSWAVKCSF--GTVNARLTSGWKEFVLDNNLKVGDVCVFERVNRSKRLFNVIIF 103 699*************66..333345***********************99987776666665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.40.330.10 | 4.0E-19 | 10 | 104 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 2.22E-19 | 13 | 104 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 1.06E-15 | 16 | 103 | No hit | No description |
SMART | SM01019 | 1.3E-5 | 18 | 106 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 1.7E-14 | 43 | 103 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 12.774 | 44 | 106 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MIIAYQRAKA YTSENPFFVC FMHPSYVSSA NRPIRLCYGL YSDVILQNSS TRSWAVKCSF 60 GTVNARLTSG WKEFVLDNNL KVGDVCVFER VNRSKRLFNV IIFTSAEVCK ELELARLHVV |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019230753.1 | 3e-52 | PREDICTED: uncharacterized protein LOC109211655 isoform X1 | ||||
Refseq | XP_019230763.1 | 3e-52 | PREDICTED: uncharacterized protein LOC109211655 isoform X1 | ||||
Refseq | XP_019230770.1 | 3e-52 | PREDICTED: uncharacterized protein LOC109211655 isoform X1 | ||||
Refseq | XP_019230784.1 | 2e-52 | PREDICTED: uncharacterized protein LOC109211655 isoform X3 | ||||
TrEMBL | A0A1J6IMU6 | 2e-50 | A0A1J6IMU6_NICAT; B3 domain-containing transcription factor vrn1 | ||||
TrEMBL | A0A1J6INP2 | 7e-51 | A0A1J6INP2_NICAT; B3 domain-containing transcription factor vrn1 | ||||
STRING | XP_009613660.1 | 5e-50 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA759 | 18 | 93 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18990.1 | 4e-12 | B3 family protein |