![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf02380g01006.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 107aa MW: 11892.8 Da PI: 8.8097 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 128.2 | 3.7e-40 | 8 | 95 | 1 | 88 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 +Ca+Ck+lrr+CakdC++apyfp+++p+kf +vhk+FGasn++k+l+++p ++r da+ss+vyeA+ r+rdPvyG++g i+ lq+ + Niben101Scf02380g01006.1 8 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFGIVHKVFGASNISKMLQEVPVNKRADAVSSIVYEANTRMRDPVYGCLGAISYLQKYV 94 7***********************************************************************************988 PP DUF260 88 e 88 e Niben101Scf02380g01006.1 95 E 95 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.151 | 7 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.0E-39 | 8 | 95 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MGATGNSPCA SCKLLRRRCA KDCIFAPYFP SDDPHKFGIV HKVFGASNIS KMLQEVPVNK 60 RADAVSSIVY EANTRMRDPV YGCLGAISYL QKYVEIFLCS FPSTTYQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-39 | 5 | 94 | 8 | 97 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-39 | 5 | 94 | 8 | 97 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019229583.1 | 1e-61 | PREDICTED: LOB domain-containing protein 12-like isoform X2 | ||||
Swissprot | Q8LBW3 | 3e-55 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | A0A1S3X5C4 | 9e-58 | A0A1S3X5C4_TOBAC; LOB domain-containing protein 12-like | ||||
STRING | XP_009764881.1 | 1e-57 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 1e-57 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|