PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf02210g01002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 243aa MW: 27556.5 Da PI: 9.5822 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 151.6 | 3.8e-47 | 16 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+++d++k++PwdLp e+e yfFs+r+ k+ +g+r+nrat+sgyWka Niben101Scf02210g01002.1 16 LPPGFRFHPTDEELVVQYLKRKVFSFPLPA-SIIPDIDVHKSDPWDLPGD---LEQERYFFSTREMKHLKGNRSNRATNSGYWKA 96 79****************************.89***************54...46799*************************** PP NAM 86 tgkdkevlskkgel.....vglkktLvfykgrapkgektdWvmheyrl 128 tg dke++s +g++ vg+kktL fykg+ +g +tdW+mheyrl Niben101Scf02210g01002.1 97 TGLDKEIVSCRGKQqqqllVGMKKTLLFYKGKPLHGCRTDWIMHEYRL 144 ********98444445677***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.27E-56 | 10 | 166 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.651 | 16 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.1E-26 | 17 | 144 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 243 aa Download sequence Send to blast |
MGMEKLNFVK IGAVRLPPGF RFHPTDEELV VQYLKRKVFS FPLPASIIPD IDVHKSDPWD 60 LPGDLEQERY FFSTREMKHL KGNRSNRATN SGYWKATGLD KEIVSCRGKQ QQQLLVGMKK 120 TLLFYKGKPL HGCRTDWIMH EYRLANLVPN NIPTQENWVL CRIFLKKRGS SKNEEANTTS 180 CRAGAKSKLV FYDFMNSCVP ASSSVSGSSG ITELSTNESD AHEDSSSCNS FTTLIRRKNL 240 ALD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-47 | 1 | 172 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-47 | 1 | 172 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-47 | 1 | 172 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-47 | 1 | 172 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-47 | 1 | 172 | 7 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-47 | 1 | 172 | 4 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-47 | 1 | 172 | 4 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009804476.1 | 1e-161 | PREDICTED: NAC domain-containing protein 18-like | ||||
Refseq | XP_016501117.1 | 1e-161 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 4e-87 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A1S4CIT0 | 1e-160 | A0A1S4CIT0_TOBAC; NAC domain-containing protein 83-like | ||||
TrEMBL | A0A1U7YR91 | 1e-160 | A0A1U7YR91_NICSY; NAC domain-containing protein 18-like | ||||
STRING | XP_009804476.1 | 1e-160 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-87 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|