PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf01470g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 96aa MW: 10968.3 Da PI: 4.9213 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 16.2 | 1.8e-05 | 64 | 94 | 7 | 37 |
--HHHHHHHHHHHHHSSS--HHHHHHHHHHC CS Homeobox 7 ftkeqleeLeelFeknrypsaeereeLAkkl 37 + +q+++Le+ Fe ++++ e++ +LA++l Niben101Scf01470g00001.1 64 LRVDQVKALEKNFEVDNKLEPERKVKLAQEL 94 5679*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.1E-5 | 67 | 95 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MKRVRSSDSL GVPLMSMCQN TTDDHNQWNS QVYSRDFQSM LELGLADEPC VEESGHGSEK 60 KGRLRVDQVK ALEKNFEVDN KLEPERKVKL AQELDS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. Self expression regulation. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416, ECO:0000269|PubMed:16055682}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009768030.1 | 3e-58 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like | ||||
Refseq | XP_016493903.1 | 3e-58 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like | ||||
Swissprot | P46668 | 2e-19 | ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6 | ||||
TrEMBL | A0A1S4BYI3 | 6e-57 | A0A1S4BYI3_TOBAC; homeobox-leucine zipper protein ATHB-6-like | ||||
TrEMBL | A0A1U7W1A4 | 6e-57 | A0A1U7W1A4_NICSY; homeobox-leucine zipper protein ATHB-6-like | ||||
STRING | XP_009768030.1 | 1e-57 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2718 | 24 | 53 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22430.1 | 7e-22 | homeobox protein 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|