PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB_related

Protein Properties

Length: 67aa MW: 7864.96 Da PI: 11.0857

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf01063g02004.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.8	1e-17	6	49	1	44
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +g+WT+eEd++lvd++++ G g+W++ +++ g++R +k+c++rw Niben101Scf01063g02004.1 6 KGPWTPEEDQKLVDYIHRNGHGNWRALPKRAGLNRYGKSCRLRW 49 79****************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.622	1	57	IPR017930	Myb domain
SuperFamily	SSF46689	9.18E-18	3	67	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-19	4	48	IPR009057	Homeodomain-like
SMART	SM00717	2.7E-10	5	55	IPR001005	SANT/Myb domain
Pfam	PF00249	4.3E-16	6	49	IPR001005	SANT/Myb domain
CDD	cd00167	5.48E-9	8	49	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.8E-7	49	67	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MNGLKKGPWT PEEDQKLVDY IHRNGHGNWR ALPKRAGLNR YGKSCRLRWS AIATRLRGRT 60 DNEIKNY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019259157.1	4e-32	PREDICTED: transcription factor MYB39-like
Swissprot	Q9S9Z2	7e-30	MYB93_ARATH; Transcription factor MYB93
TrEMBL	A0A314LEP5	1e-30	A0A314LEP5_NICAT; Transcription factor myb39
STRING	XP_009776410.1	8e-31	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA21622	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34670.1	3e-32	myb domain protein 93

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]