PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf00557g00003.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

HSF

Protein Properties

Length: 61aa MW: 6957.96 Da PI: 8.5142

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf00557g00003.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	32.4	2.4e-10	10	53	2	46
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHST CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFk 46 Fl k+y++++d++++++isw ++nsfvv+d+ + L+ +k Niben101Scf00557g00003.1 10 FLVKTYDMVDDPRTNKIISWGPTNNSFVVWDPPCVRQ-GLTAQWK 53 9******************999*****988777.6666666 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	8.0E-12	4	48	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	4.22E-10	5	44	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	0.0062	6	60	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	2.0E-7	10	46	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MPRANAPLPF LVKTYDMVDD PRTNKIISWG PTNNSFVVWD PPCVRQGLTA QWKINRADEV 60 S

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019267090.1	6e-19	PREDICTED: heat shock factor protein HSF8-like
Swissprot	Q40152	1e-14	HSF8_SOLLC; Heat shock factor protein HSF8
TrEMBL	A0A314L0P4	1e-17	A0A314L0P4_NICAT; Heat shock factor protein hsf8
STRING	XP_009781208.1	3e-18	(Nicotiana sylvestris)
STRING	XP_009600492.1	3e-18	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	4e-16	heat shock factor 1

Publications ? help Back to Top
Zhu B, et al. Identification and characterization of a novel heat shock transcription factor gene, GmHsfA1, in soybeans (Glycine max). J. Plant Res., 2006. 119(3): p. 247-56 [PMID:16570125] Cai SY, et al. HsfA1a upregulates melatonin biosynthesis to confer cadmium tolerance in tomato plants. J. Pineal Res., 2017. [PMID:28095626] Zhou J, et al. Heat Shock Factor HsfA1a Is Essential for R Gene-Mediated Nematode Resistance and Triggers H2O2 Production1. Plant Physiol., 2018. 176(3): p. 2456-2471 [PMID:29339397]