![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf00406g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | ARF | ||||||||
Protein Properties | Length: 140aa MW: 15547.9 Da PI: 9.2229 | ||||||||
Description | ARF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 31.7 | 2.7e-10 | 2 | 41 | 56 | 97 |
TTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS B3 56 sgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 ++r++lt+GW+ Fv+ ++L +gD vvF +++++ +v+++ Niben101Scf00406g00001.1 2 PRRHLLTNGWSAFVNGKKLVAGDLVVFL--REENGDVHVGFR 41 689*************************..446777788876 PP | |||||||
2 | Auxin_resp | 36.3 | 2.4e-13 | 67 | 121 | 1 | 57 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsser 57 a++a++++ +F+v+ +P++ s+F+++++k+++a+++ + v m fkm e +s+er Niben101Scf00406g00001.1 67 ASDALASQRPFSVYCKPQT--SQFIISLNKYLEAINRGLGVSMTFKMPSEVANSHER 121 567999***********95..9*****************************999988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 9.756 | 1 | 44 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.44E-9 | 2 | 42 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 3.7E-13 | 2 | 52 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF06507 | 6.6E-11 | 67 | 121 | IPR010525 | Auxin response factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009725 | Biological Process | response to hormone | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
HPRRHLLTNG WSAFVNGKKL VAGDLVVFLR EENGDVHVGF RHLLCQKSSV EAPIASSLDI 60 KGVLEVASDA LASQRPFSVY CKPQTSQFII SLNKYLEAIN RGLGVSMTFK MPSEVANSHE 120 RYGVFRIYLT KNLSCLTDVP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ldv_A | 1e-27 | 1 | 121 | 183 | 306 | Auxin response factor 1 |
4ldw_A | 1e-27 | 1 | 121 | 183 | 306 | Auxin response factor 1 |
4ldw_B | 1e-27 | 1 | 121 | 183 | 306 | Auxin response factor 1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019230992.1 | 1e-74 | PREDICTED: uncharacterized protein LOC109211859 isoform X3 | ||||
TrEMBL | A0A1S3Z5Y3 | 2e-72 | A0A1S3Z5Y3_TOBAC; Auxin response factor | ||||
TrEMBL | A0A314KI65 | 1e-72 | A0A314KI65_NICAT; Auxin response factor | ||||
STRING | XP_009625168.1 | 1e-71 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46530.2 | 3e-33 | auxin response factor 11 |